KEGG   Gallus gallus (chicken): 395323
Entry
395323            CDS       T01006                                 

Gene name
KDR
Definition
(RefSeq) vascular endothelial growth factor receptor 2 precursor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04370  VEGF signaling pathway
gga04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395323 (KDR)
   04370 VEGF signaling pathway
    395323 (KDR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395323 (KDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395323 (KDR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    395323 (KDR)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     395323 (KDR)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   395323 (KDR)
CD molecules [BR:gga04090]
 Proteins
  395323 (KDR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C2-set_2
Other DBs
NCBI-GeneID: 395323
NCBI-ProteinID: NP_001004368
CGNC: 10404
Ensembl: ENSGALG00000013907
UniProt: Q677M1
Position
4
AA seq 1348 aa
MELGPLRVLTVLLCLPPVFTGLFISMDQPTLSIQKSVLTITTNDTLNITCSGQRAVYWSW
PNNQSNAEKRLAVTGCSDGPFCKTLTLLRVIGNDTGDYRCLYGDSQAATTIYVYVQDYRS
PFVTSVGDQLGIVYITKNKTVVVPCLGTVSNLNVSLHAKYPEKVFVPDGKSISWDNKKGF
TIPSHLISYAGMVFCEAKIDNESYQSVIYIVAVVGYRIYDLTMNPHYQVELAVGEKLVLN
CTVRTELNVGIDFKWDYPSIKEKRATIRDLKTTAGEIKTFVSTLTIDSVNLSDKGRYTCA
ASSGRMNMKNSSYFIIHESPFIHLEKMENVVEMKLGDTVSIPVKFKGYPSPEAKWYKNGK
VMNANHTVKLGYTLVITDATEKDAGNYTVVLTNPTNKMQKRHTFTLLVNVPPQIGENALM
APVDSYKYGSTQTLTCTIYAVPPPAAVLWYWQLEEECTFSPQKVRLGANPYACRKWKVIS
ERKGGNQVEIKQRVVTIAGKTKTVSTLVIQAANVSALYRCMATNRAGSSERVISFHVTRG
LEINLQPRSQLTEKDNTSLQCTADKFTFEKLSWYKLSAHALQTPFGGLPMPVCKNLDALQ
KLNATVSNTNGENVTLELILRNISLQDGGDYVCIAQDKKAKTQHCLVKHLTVQEPMAPTL
VGNLENQTTNIGETIEVSCTVNGIPPPNITWFKNGETLFEDSGIVLKDGNKTLTIRRVRK
EDGGLYTCLACNILGCKKAEAYFSVEGAEEKTNLELIILVGTAVIAMFFWLLLVIILRTV
KRANGGDMKTGYLSIIMDPDEVPIDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVI
EADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPG
GPLMVIVEYCKFGNLSAYLRSKRSEFVPYKTKSARFRQGKENYIGDISTDLKQRLDSITS
SQSSTSSGFVEERSLSDVEEEDAGSEDLCKNPLTMEDLICYSFQVARGMEFLASRKCIHR
DLAARNILLSDNNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSD
VWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGDP
KQRPTFSELVEHLGNLLQANVRQDGKDYVVLPLSVSLNMEEDSGLSLPTSPASCKEEEEV
CDPKFHYDNTAGISQYRQGSKRKSRPVSVKTFEDIPLVTTVKVVQEENQTDSGMVLASEE
LKTLEERDKQVKIPFSTLAPSKSNESVMSEASNQTSGYQSGYHSDDMDTMVCSSEDTELL
CAQEASPTLPRVHGLVHDSPAPLVSPPL
NT seq 4047 nt   +upstreamnt  +downstreamnt
atggaactggggccgctgcgggtgctgacggtgctgctctgcctgcctcccgttttcaca
ggtttgtttatttctatggatcagccaacccttagtatccaaaaaagtgtcctcaccata
accacaaatgatactctgaacattacttgcagtggtcagagggccgtgtactggtcctgg
cccaataaccagagcaatgctgagaagcgccttgctgtgacaggctgcagcgatggcccc
ttctgcaagaccctcaccctcctcagagtcataggcaacgacaccggggactacaggtgc
ctttatggagacagccaggcagctacaaccatttatgtctatgttcaagattaccgatct
ccatttgtgacttcggttggtgatcagcttggcattgtgtacatcactaagaataaaact
gtggtagtaccatgccttggaactgtgtcaaatctcaatgtatctctacatgcgaaatat
ccagaaaaggtatttgttcctgatggcaaatcaatttcgtgggataataaaaaaggcttc
actatacccagtcatctaatcagctacgcaggcatggtcttctgtgaagctaaaatagat
aacgaaagctaccagtctgtgatatatatcgtcgcggttgtaggttataggatttatgat
ctaacaatgaacccacactaccaagttgagctggcggtaggagaaaaactagttctcaat
tgtactgtaaggacagagctgaacgtgggaattgattttaagtgggactacccttccatc
aaggaaaagcgtgcaaccataagagatttaaaaaccactgcaggagaaataaagacgttt
gtaagcactcttaccattgacagtgtgaacttaagtgacaaaggtcgatacacgtgtgca
gcatccagtggtcgcatgaacatgaagaacagcagctacttcattatccatgaaagtcct
tttattcatttagaaaaaatggagaatgtggttgagatgaagttaggtgatacagtcagt
attcctgtgaagtttaaaggatacccttctccagaggcaaaatggtacaaaaatggaaaa
gtcatgaatgcaaatcatacagttaagcttggctatacattagtaatcactgatgcaact
gagaaggatgccgggaattacactgttgtccttacaaaccctaccaacaagatgcagaag
agacatacattcactctgcttgtgaatgtccccccccagattggtgagaatgcgctgatg
gcccctgttgactcctacaagtatggctcaacgcagacactcacgtgcaccatctatgcc
gtcccaccacccgccgccgtcctgtggtattggcagctggaggaggagtgcaccttcagc
ccccaaaaagttcgcctgggagccaatccatatgcatgcagaaaatggaaagtgatctca
gagagaaagggtgggaatcaggttgaaatcaaacagcgagttgttactattgctgggaaa
acaaagactgtgagcacccttgtgattcaagcagcaaatgtatctgctttgtacagatgt
atggctactaacagagctggatcaagtgaaagagttatctcctttcatgtgaccagaggt
cttgaaattaatctccagcctcggagtcaactgacagagaaggataacacgtccttacag
tgcacagctgataaattcacctttgagaagctatcgtggtacaaactcagcgctcacgcc
ttacagacaccctttggagggctgcccatgcctgtttgcaagaaccttgatgctcttcag
aagctgaatgcaactgtttcaaataccaacggtgaaaatgtcaccttagaactcattctc
cgtaacatctccctccaggatggaggcgactatgtttgcattgctcaggacaagaaggct
aaaacacagcactgcctggtgaagcacctcactgttcaagagcccatggcacccacactt
gtgggaaatctggaaaatcaaacaacaaacattggtgaaaccatagaagtgtcatgcaca
gtaaatggcattcctcctccaaacatcacgtggtttaaaaatggtgaaacactttttgaa
gattcaggtatcgttttgaaagatggaaacaaaacactaactatacgtagagtgaggaaa
gaagatggagggctgtacacttgccttgcctgcaatattcttggatgcaaaaaagcagag
gcttatttttcagtggaaggcgccgaagagaaaacaaatctggagctcattatccttgtt
ggcactgcagtgattgccatgtttttctggttgcttcttgtaatcatccttcggaccgtt
aagcgggccaatggaggtgacatgaagactgggtacttgtcaatcatcatggatcctgat
gaagtccccatagatgagcactgcgagcggcttccgtatgatgccagcaagtgggagttt
cccagagaccgactgaagctaggtaaacctcttgggcgtggagcttttggccaagtcata
gaagctgatgcctttgggattgacaaaactgctacctgcagaactgtggcagtcaaaatg
cttaaagagggtgcaactcacagtgagcacagagcacttatgtccgagctgaagatcctc
attcacattggtcatcatctcaacgttgtcaatttacttggagcctgcacaaagccaggg
ggcccactcatggtgattgtagaatactgcaagtttggaaatctctcagcatacctacgg
agcaagaggagtgaatttgtcccatacaagactaaaagtgccaggtttcggcaaggtaag
gaaaactacattggggacatctccacagacctgaagcaaagattggacagcatcacgagc
agccagagctccacaagctccggctttgtggaagagcggtccctgagcgacgtggaagag
gaggacgctggttctgaagacctttgcaagaaccctttgaccatggaggacctcatctgt
tatagcttccaggtggccagagggatggagttcttggcttcacgcaaatgcatccacagg
gacctggctgctcgtaatatcctcttgtcagacaataacgtggtcaaaatctgtgatttt
ggcttggctcgagacatctacaaagacccagattacgtcaggaaaggagatgctaggcta
ccgctaaaatggatggcaccagaaaccatttttgatagagtatataccattcagagtgat
gtgtggtcatttggagttctgctgtgggaaatattttcattaggtgcatcaccataccct
ggagtgaaaattgatgaggaattttgcagaagactgaaggaaggcacaagaatgagagca
ccagactatacaacaccagaaatgtaccaaactatgttggattgctggcatggagatcct
aagcagagaccaactttttcagagctggtggagcacctggggaatttactgcaagccaac
gtccgtcaggatggtaaagactacgttgtccttcctttgtcagtatcgctgaatatggaa
gaggattcgggcctctctctcccaacttcacctgcttcctgtaaggaggaagaggaagtc
tgtgatcctaaattccattatgacaacacagcaggaattagtcagtaccgacaaggtagc
aaaaggaaaagtcgacctgtgagtgtgaaaacttttgaagatatcccattggtaaccact
gtaaaagttgttcaggaggaaaaccagacagacagtgggatggttcttgcatctgaagag
ctgaagacactggaagagcgagataaacaagtcaaaatacccttcagcacactagcgccc
agcaagagcaatgagtctgtcatgtccgaggcatccaaccagacaagtggctaccagtca
gggtatcactcagatgacatggacaccatggtctgttccagtgaggacactgaactcttg
tgcgcccaggaggcctcccccacgctgcctcgtgtgcatggcctggtgcatgacagccct
gcgcctcttgtgtccccgccactctag

DBGET integrated database retrieval system