KEGG   Gallus gallus (chicken): 395326
Entry
395326            CDS       T01006                                 

Gene name
NFIL3
Definition
(RefSeq) nuclear factor interleukin-3-regulated protein
  KO
K09059  nuclear factor, interleukin 3 regulated
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395326 (NFIL3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   bZIP/PAR
    395326 (NFIL3)
SSDB
Motif
Pfam: Vert_IL3-reg_TF bZIP_2 bZIP_1
Other DBs
NCBI-GeneID: 395326
NCBI-ProteinID: NP_989949
CGNC: 11317
Ensembl: ENSGALG00000015209
UniProt: Q90Z72
Position
Z
AA seq 458 aa
MQLRKMQTLKKEHGSVDTSSNVDKIMVLKSTLAEVSEELSTNEDILLTEASSGKSKSSAC
RRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL
SLKLKFGLISSASYAQEIQKLSSSTTVYFQDYQSSKPNINSFVDEHEPSVVGSSCISVIK
HSPQSSMSDMSEMPSVEHTQGSRIQSNCRSPENKFQIIKQEPIELEREPRDDRGSYKASI
YPNYMGTTFNMYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV
EHKNVHATVKVPEVNSSALPHKLRIKAKAMQVKVEAMDNDYDATQKLSSPIDMSSKRHFE
LEKHGAQNLVHSSHTPFSVQVTNIQDWSLKPELWHQKELNVKIQNGCKTGVVEIKDNVYN
VSESENLYLKQGIANLSAEVASLKRLITTQQISASDSG
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgcagctgagaaaaatgcagacccttaaaaaggaacacggatctgttgacacaagtagc
aatgtggacaaaatcatggtacttaaatctactttagcagaagtgtctgaagagttgtct
acaaatgaagatatactacttactgaagctagtagtggaaaaagcaaatcttcagcttgc
cggagaaagcgagaattcattccagatgaaaagaaggatgctatgtattgggagaaaagg
cggaaaaataatgaagctgccaaaagatctcgtgaaaaacgacgactgaatgaccttgtc
ttagagaacaaactaattgcactgggagaggagaatgccactttgaaggccgagctgctt
tcattgaagctaaagtttggtttaattagttctgcatcctatgcccaagagatacagaaa
ctcagtagctcaacaactgtgtatttccaagactatcaaagttccaaaccaaatattaac
tcatttgtagatgaacatgaaccatctgtagttggtagcagttgtatttctgtcattaag
cattctcctcaaagctctatgtccgatatgtctgaaatgccatcagttgagcatactcaa
ggaagtcgtatacaaagcaactgcagaagtcctgaaaataagttccagattataaaacag
gagcccatagaattagagagagagccaagagatgacagaggttcatacaaagcatccata
tatccaaactacatgggaactaccttcaacatgtactcacattctccgcctctcttgcaa
gtcaataggtcctccagtaattcccctagaacttcagaaactgatgatggagttgttgga
aagtcatctgatggagaagatgagcagcaggttcctaagggtccaatccattctccagtt
gaacataaaaatgttcatgcaacagttaaagttccagaagtgaattcttctgctttgcct
cacaagcttcgaattaaagccaaagccatgcaagttaaagtggaagcaatggataatgac
tatgatgccacacagaaattgtcatcacctattgatatgtcctcaaaaagacattttgag
cttgaaaaacatggtgcacagaacttggtgcattcttctcacactcctttctcagttcag
gtgacaaacatccaagactggtcactcaaaccggaactctggcatcaaaaagaactcaat
gtaaaaattcagaatggttgcaaaactggagttgttgaaataaaagacaatgtctacaat
gtctctgagtctgagaacctgtatttgaagcagggcatagcaaacttatctgcagaggtt
gcttcacttaaaagacttataactacacaacaaatttctgcatcagactctggttaa

DBGET integrated database retrieval system