KEGG   Gallus gallus (chicken): 395328
Entry
395328            CDS       T01006                                 

Gene name
HOXD11
Definition
(RefSeq) homeobox protein Hox-D11
  KO
K09296  homeobox protein HoxC/D11
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395328 (HOXD11)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    395328 (HOXD11)
SSDB
Motif
Pfam: DUF3528 Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 395328
NCBI-ProteinID: NP_989951
CGNC: 7045
Ensembl: ENSGALG00000039629
UniProt: P24342
Position
7
AA seq 280 aa
MTEFDDCSHGASNMYLPGCAYYVSPSDFSTKPSFLSQSSSCQMTFPYSSNLPHVQPVREV
AFREYGLERGKWQYRGSYAPYYSAEEVMHRDFLQPANRRTEMLFKTDPVCGHHGASPAAS
NFYGSVGRNGILPQGFDQFYEPAPAPPYQQHSEGEGDADKGELKPQHSACSKAPSGQEKK
VTTASGAASPPGEAVAEKSNSSAVPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQ
LSRMLNLTDRQVKIWFQNRRMKEKKLNRDRLQYFTGNPLF
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaccgagtttgacgattgcagtcacggcgcatccaatatgtatctgccagggtgcgct
tattacgtctcgccctcagacttctcgacgaaaccctcttttttgtcgcaatcgtcttcc
tgtcaaatgacttttccttattcttctaatttacctcatgtccaacctgtgcgcgaagtg
gcattcagggaatacggattagagcgcggcaaatggcagtacaggggcagttacgctccc
tattactcagctgaagaggtgatgcacagagactttctgcagcccgcgaacaggaggacg
gaaatgctattcaaaacggaccccgtgtgcggccaccacggagcgtcccccgccgcctcc
aacttctacggctcggtggggaggaacggcatcctgccgcagggcttcgaccagttctac
gagccggcccccgcgcccccgtaccagcagcactccgagggcgagggggacgcggacaag
ggcgagctgaagccccagcacagcgcctgcagcaaggcaccttccggccaggagaagaaa
gtgacaacggcgagcggcgccgcttcccctcccggtgaggctgttgcagagaagagcaac
agttcagcagttcctcagcgatcgaggaaaaagaggtgtccctataccaaatatcagata
agagaactggaacgtgagtttttcttcaacgtgtacataaacaaagagaaaagactgcag
ttgtccagaatgctcaacctcactgaccggcaagttaaaatctggttccagaatcgaagg
atgaaagaaaagaaactgaacagagatcgactccaatacttcactggaaatcccttgttt
tga

DBGET integrated database retrieval system