KEGG   Gallus gallus (chicken): 395332Help
Entry
395332            CDS       T01006                                 

Gene name
TES
Definition
(RefSeq) testin
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: PET LIM Ig_Tie2_1
Motif
Other DBs
NCBI-GeneID: 395332
NCBI-ProteinID: NP_989954
CGNC: 7146
Ensembl: ENSGALG00000031934
UniProt: Q90YH9
Position
1
AA seq 422 aa AA seqDB search
MDLESKVKKMGLGHEQGFGAPCLKCKDKCEGFELHFWRKICRNCKCGQEEHDVLTSNEED
RKVGKLFEDTKYTTLIAKLKNDGIPMYKRNVMILTNPVPAKKNISINTVTYEWAPPVQNQ
TLARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPNEVKQMEQFVK
KYKNEALGVGDVKLPGELETKATDKNNVNSGDRSTSAAVGAMEDKSADQKASQYSCYRCK
LNMKEGDPAVYAERAGYDKLWHPACFVCCTCSELLVDMIYFWKNGNLYCGRHYCDSEKPR
CAGCDELIFSNEYTQAEGQNWHLKHFCCFDCDCVLAGEIYVMVNDKPVCRPCYVKKHAAI
CQGCHNAIDPEVQRVTYNNFNWHATQECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKKM
MS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacttggaaagcaaagtgaaaaagatgggcttgggccatgaacagggatttggtgcc
ccctgcttaaaatgcaaggataagtgtgaaggatttgagcttcatttctggagaaaaata
tgccgcaactgcaagtgtggccaggaagagcacgatgtcctcacaagcaatgaagaagac
aggaaagtggggaaactctttgaagatacaaaatatacgactcttattgcaaagctgaaa
aatgatggcattcccatgtataaacgtaacgtaatgattctgactaatccagtgccagcc
aagaagaacatatccatcaacactgtgacctatgagtgggctcctcctgttcagaatcag
acacttgctagacagtatatgcagatgctaccaaaggagaaacagcctgttgctggctca
gaaggcgctcagtacaggaagaagcagttggctaagcagctgcctgctcacgatcaggat
ccttcaaaatgccatgagctatcccccaatgaagttaaacagatggaacaatttgtgaag
aagtacaaaaatgaagcacttggtgtaggagatgtgaagctccctggtgagctggaaact
aaagcaactgacaagaataacgtgaacagtggggacagaagtacctcagctgctgtagga
gcaatggaggacaagtcagcagatcagaaggcatctcaatactcctgctatcgctgcaag
ctgaacatgaaagaaggtgacccagctgtctatgcagaacgtgcaggatatgacaaattg
tggcacccagcttgttttgtctgttgtacctgcagcgaacttctagtagacatgatctat
ttctggaagaatggcaacctgtactgtggaagacattattgtgatagtgaaaaaccccgc
tgtgctggatgtgatgagctaatattcagcaatgaatatactcaagcagaaggtcaaaac
tggcatctgaaacacttctgctgttttgactgtgattgtgttttggctggagaaatctat
gtcatggtgaatgacaagccagtctgcagaccatgctatgtgaagaaacatgctgcgatc
tgccaaggctgtcataacgctatagatccagaggttcagcgtgtgacctacaacaacttc
aattggcatgctacacaggagtgtttcttgtgttcctgttgtagcaagtgtttaattggc
cagaagtttatgccagtggaagggatggtcttttgctcagtggaatgtaagaagaagatg
atgtcttaa

DBGET integrated database retrieval system