KEGG   Gallus gallus (chicken): 395356Help
Entry
395356            CDS       T01006                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 precursor
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00010  Glycolysis / Gluconeogenesis
gga00562  Inositol phosphate metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    395356 (MINPP1)
   00562 Inositol phosphate metabolism
    395356 (MINPP1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     395356 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     395356 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 His_Phos_1 DUF4708
Motif
Other DBs
NCBI-GeneID: 395356
NCBI-ProteinID: NP_989975
CGNC: 2703
Ensembl: ENSGALG00000003695
UniProt: F1NPQ2
Position
6
AA seq 449 aa AA seqDB search
MAPCRAACLLPLLVAVASAGLGGYFGTKSRYEEVNPHLAEDPLSLGPHAAAARLPAACAP
LQLRRVVRHGTRYPTAGQIRRLAELHGRLRRAAAPSCPAAAALAAWPMWYEESLDGRLAP
RGRRDMEHLARRLAARFPALFAARRRLALASSSKHRCLQSGAAFRRGLGPSLSLGADETE
IEVNDALMRFFDHCDKFVAFVEDNDTAMYQVNAFKEGPEMRKVLEKVASALCLPASELNA
DLVQVAFLTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINSRSSCI
LFQDIFQQLDKAVDESRSSKPISSPLIVQVGHAETLQPLLALMGYFKDAEPLQANNYIRQ
AHRKFRSGRIVPYAANLVFVLYHCEQKTSKEEYQVQMLLNEKPMLFHHSNETISTYADLK
SYYKDILQNCHFEEVCELPKVNGTVADEL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtgccgcgctgcctgtctgctgccgcttctggtagcggtggcgagcgccggg
ctgggcggctacttcggcaccaagtcccgctacgaggaggtgaacccgcacctggcggag
gacccgctgtccctcgggccgcacgccgccgccgcccggctgcccgccgcctgcgccccg
ctgcagctccgccgcgtcgtccgccacggcacccgctaccccacggccgggcaaatccgc
cgcctggccgagctgcacggccgcctccgccgcgccgccgccccgtcctgccccgccgcc
gccgcgctggccgcctggccgatgtggtacgaggagagcctcgacgggcggctggcgccg
cggggccgccgcgacatggaacacctggcgcgccgcctggccgcccgcttccccgcgctc
ttcgccgcccgccgccgcctggcgctggccagcagctccaagcaccgctgcctgcagagc
ggcgcggccttccggcgcggcctcgggccctccctcagcctcggcgccgacgagacggag
atcgaagtgaacgacgcgctgatgaggttttttgatcactgcgacaagttcgtggccttc
gtggaggacaacgacacagccatgtaccaagtgaacgccttcaaagagggcccggagatg
aggaaggtgttggagaaggtggcgagtgccctgtgtctgccggccagcgagctgaacgca
gatctcgttcaagtggctttcctcacttgctcgtatgagttggctataaaaaatgtgacc
tccccgtggtgttcgctcttcagtgaagaagatgctaaggtactggagtacctgaatgac
ctgaagcaatactggaagagaggatatggctatgacatcaatagtcgctccagctgcatt
ttattccaggatatcttccagcagttggacaaagcagtggatgagagcagaagttcaaaa
cccatttcttcacctttgattgtacaagttggacatgcagaaacacttcagccacttctt
gctcttatgggctacttcaaagatgctgagcctctccaggccaacaattacatccgccag
gcgcatcggaagttccgcagcggccggatagtgccttatgcagccaacctggtgtttgtg
ctgtaccactgtgagcagaagacctctaaggaggagtaccaagtgcagatgttgctgaat
gaaaagccaatgctctttcatcactcgaatgaaaccatctccacgtatgcagacctcaag
agctattacaaggacatccttcaaaactgtcacttcgaagaagtgtgtgaattgcccaaa
gtcaatggtaccgttgctgacgaactttga

DBGET integrated database retrieval system