KEGG   Gallus gallus (chicken): 395357Help
Entry
395357            CDS       T01006                                 

Gene name
CENPF
Definition
(RefSeq) centromere protein F
  KO
K11499  centromere protein F
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    395357 (CENPF)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     395357 (CENPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-F_N CENP-F_leu_zip CENP-F_C_Rb_bdg
Motif
Other DBs
NCBI-GeneID: 395357
NCBI-ProteinID: NP_989976
CGNC: 7370
Ensembl: ENSGALG00000009690
UniProt: E1C703
Position
3
AA seq 2935 aa AA seqDB search
MSWAVEEWKEGLSPRVLQKIHELESQVDKLKKERQQRQFQLESLEAALQKQKQKVENEKN
ETAILKRENQSLMELCDSLDKAKQKNSHDLQVKESQVNILSGQLSSSKKEIERLEQELKR
YKCELERSQQSLIAAELSFSGTPQKSFTAPLTPVQSHNDAKFEELEEKYKKEVQERKKLE
LELRTIQVKKINQPYLQQSSLSHREIARHQASSSVFSWQQEKTPSRNQETPAKRTSSTPY
FPWEKEGNSSIKSEKNKFDNSFSEDCNSLLINQLRAQNQELNSTIKDLEQQLQALEKEKK
SHMNKYQETELQLDRMKLELTEKDKVLNKTRDKLTQMKTQFDQATVQVQAMEQKMKRLSE
ELNCQRQNAESARQSLEQKIKAKEKEYQEELSCQQRSLQKLDQQNSDVRNKLNQELQQAK
NDFNALQAELDKVIAVKQRLERDTSDLTQKLCRAEQALLAAQAKETDLTRNFEDVKKEKN
LLDAQYEKKLREIHQLEEELGAVKQSLKQSQNFAEEMKNKNTSQEAELKLLEEKFIKQEN
SLSLEKLKLALADTEKQQRSTENLLKEKENHIKEQNCKISKMEEELEALQRLLEFKQREC
EELKKETNAFSQWRNENDHVINKLKLEKEDMLIHIRDLESSLQSQQIENREHSEKFKIME
TERDRKNIEIKELRDMLGCKSAELEEQKKVCDELRQEAECSDKKYCKDIENMSCKILQLT
NQVSELEEKIQLAASEGLQREQYYHELLGEYEKICCLVKAKDTSEMTEDAEDYLQSGQDE
TVLGNKQLAANKPVAKGHGCTRALLGIEKMKDMMVLQDQISFLEISPVAQKQLNSDQQHQ
DEDLPQIESETEERLCDVEQRHESFITETNQYISNLQADISAHQKSIRKTVAIIEKKDMQ
LQSLRERLENQQTELQDLKTSNKFLEDSVRQLKLMSEMWGSEKKDMSSVICSYSKEIEEL
TGENATLKDLSRDLEQNQITLLEANRNISNSLKEKEEIISEMSRKHKEEKQCMEARTEEI
SRELKVLQAQYKLVEEENVNVMSILREQTVVFEEKKAELEQEEKLVLNENKYILHKLIAS
EEIKKNLIQELQQLQSGFSDVERVPSPELDCLKQGMSNVKATQNGIQEQHGTVCIQGREQ
LVKELETKSEPLAYDFSCERKVCSDQLRKIMEEKDTELNKYQLNLELLHMDLEDREVSLE
NYRLEVMQLKTDLKKMETELEKSVREKETLQQELLSVKELKASYSQLRLLSEDSQLEDND
DDVSHNCGKRGMDEFVLSSSLQVITNKLSELEKICERLQNENTAFASPFKDSKTDGIRDI
NKMAEEKENIINTNLRTEKAAFQDELLDQSDNSDLRMDCGNKEISFRFKEHSTGSSSDYE
DLKLSSEEVKIYFAEIKDKFFSFQNEHMKLYEQHCSMVSKIMELQSCIKILRAENSALSA
SMSSVHLDSLRILLSSSQNDTQSKLDETKSTDSLLDVTFSEVSKVDNSCNGGVCKWTDEI
NQLKNSVEGMSEDAAKVLIEDDHSGHILDSVKELRSSTPSKYNPEGRIKELEMLCQIYEK
VIKVLQNQLHIQENMKTEEIQEMKNIMLSERREIDKLQNLSDKKEWQQKLNYLTTEMECK
LAEEGKTKNLSFDLKTASPQLQVLNSGSLSLPCTDTENTTQKKNNTLYQLGVPVGNPALR
KNKPKLIPVEKTAVGETAVHENTTETTESKLVEAFSNKFHRGEECRNMSGKNTSSSHHDS
ALSFSNSSIFLSSEDFFENEISTETHQKEIKQKTIEDPKLIYAPEGHKNVDFLMEVKELN
SQVDFQNAQLTLENSTLIELEETAVEKEENSGIKEKLESASVSKQQLSCGVVSLGKEPEK
ISAKHNVNKTVLSNTTDTLDDIELTKGNCHDLFLGAEIEQRQTKSEQVNMETHALFVEGN
AEILQAKCQQLERDREINLQTIPSSLQEQLVSVTAERNHIGQEQSVLSENKKELGQEYQK
LQEKLKELETNKEDSAKTIRRLEREVKIQTNLLETAKSDTDQLSGEKDHLLQNLQSLEKD
ALSFRLEEEKLQNQVADLNKEKEVLMRESEMMQSKLSALEIENSKLSRYLDGLITEKREL
AARLNSAQKEVNQMREGMEKLKIKIESDERKKRHIAEKLKENERKSDALLDKVERLEREL
EMSEENLEDAVVQLETAKAEAETFITEKEEMAEKLKCLQSQIDDLTSQKECLAKDSKEKQ
ERILELESSNLTTAKLLEEKEEEKMQIKDEFENAVLLLKSELKGMSEKLEFSSKEEEFAR
AKEQVLINQVACLEQDKTMLLQECQELKNENIKLDHTRELLAQEVVEYKQKLEEKMQENH
AFQQQIKETEELSSQLTRMEHEHECWHQEKQKLQNLIVELNLKAQPFSDDGTFPDILNIL
KVAYNDLEKELESTLCEKTALCKKVNEQTENCIKLEVKLSDAEQAISKLQEEFTMERKKL
AEQIQLLQEHSEQNKIDLHLVVSEKHELTKSLGAVQKELQEKENIMKREISKYQDKLLQT
EKEHQNALKEANRKNEIQIEACQEKVNSLECFISSQKLEIEHLNSTKEELNNSLKEANQT
LGELLKLKADNINTIVQLNKEKEFVQSEVQLWIKSCKQMEQEKEVLQKQLADCEELLKKK
DLSTDENAITEEIKLELEELQEAVEVKTREANENLEKYCSLIVKYYKLEEANEMLKMQVT
LLNGQLKQRTSDAVSSSLLNSGNSSTVSSQSDKEMRWNEDTTKPSTKRQRCEDTRKDNGE
PRSPLPETSSKKKRKEDICQNLENQENSDYEPDGLPEVVKRGFADIPTERVSPYILRRTT
LNLWTSPHLASQSENLPIPTQHVQTGRWDHLGEHSYSTPGGSKSQKINDEQQSQARTAFS
PMKSSTRSPLWPYKQSTNIVSDNIRETHMIHKGKDSQNEQALPKQDQQQENCKVQ
NT seq 8808 nt NT seq  +upstreamnt  +downstreamnt
atgagctgggctgtggaggagtggaaggaaggcctgtccccccgggtccttcagaagatc
cacgagctggagagtcaggtggacaagctgaaaaaagagcgtcagcaaagacagttccag
ttggaatctctggaggcagctttgcaaaagcagaaacagaaggttgaaaatgaaaaaaat
gaaactgcaattctaaaaagggagaaccagagcctgatggaattgtgtgatagtcttgac
aaagcaaagcagaaaaattcacatgatcttcaagtaaaagaatctcaagtcaacattctg
tcagggcagctgagttccagcaaaaaagaaattgaaagattagaacaagaactgaaaaga
tacaaatgtgagcttgagagaagtcagcagtcattgattgcagcagagttgtcgttcagt
ggtactccacagaaaagttttactgctcctttaacaccagttcaaagtcataacgacgct
aagtttgaagaattagaagaaaaatataagaaagaagtacaagaaagaaagaagctagag
ctagaactgagaaccattcaggttaagaaaataaatcagccttatcttcaacagagctct
ttgagtcacagggagatcgctcgacatcaggcttcttcatctgtgttttcatggcaacaa
gaaaaaacaccatctagaaatcaagaaacccctgcaaaaagaacttcttcaacaccctat
tttccatgggaaaaagaaggcaattcaagtataaaatcggagaagaacaagtttgacaac
agcttttctgaggattgtaactctttgctcatcaaccagctaagagcacagaaccaagag
ctaaattccaccattaaagacctagaacaacaactgcaagctctagaaaaagagaagaaa
tcccatatgaataagtatcaagagactgaacttcagctggacagaatgaagctggaatta
acagagaaagataaagtcttgaacaaaaccagagataaactgactcaaatgaagacacaa
tttgatcaagccaccgtacaggtccaagcaatggagcaaaagatgaaaagattgtcagaa
gaactgaattgtcaaagacaaaatgctgagagcgctcgtcagtccttggaacagaaaata
aaggcaaaggaaaaggaataccaagaggaactctcttgtcagcaacgttccttgcaaaag
ctggatcagcagaacagtgatgtaagaaacaaactgaatcaggagctacagcaagccaaa
aatgacttcaacgctctgcaggcagaattagacaaagtaatagcagtgaaacaacgcttg
gaacgtgataccagtgatcttacccagaagctgtgcagagcagaacaggcattattggca
gctcaggctaaggaaacagatctcacaagaaactttgaggacgtgaagaaggagaaaaac
cttcttgacgcacagtatgaaaaaaagctgcgagaaatccaccagcttgaagaagaatta
ggagcagtcaagcagtctctaaagcagagccagaactttgcagaagagatgaaaaataag
aatacttctcaggaggcagagctgaagttactagaagagaaatttataaagcaagagaac
tccctttccttggagaaactgaaactagctttagctgacacggaaaagcagcaacgttct
actgaaaatctgctcaaggagaaagaaaatcatattaaagaacaaaactgtaaaataagt
aaaatggaggaagagttggaagctttgcagagactccttgaattcaagcagagagaatgt
gaagaattaaaaaaagaaacaaatgctttttctcaatggagaaatgaaaatgatcacgtt
ataaataaactgaagttggaaaaggaagatatgctgattcatataagggacttggagagc
tccctccaaagccagcaaattgaaaatcgtgaacacagtgagaaattcaaaataatggaa
actgaaagagacaggaagaacatagaaatcaaagagcttagagacatgctaggatgtaaa
agtgcagaattagaagaacagaaaaaagtttgtgatgaacttcgacaagaagcggaatgt
tctgataaaaagtactgtaaagacatagaaaatatgtcctgtaaaatattacagcttacc
aaccaagttagtgaactagaagaaaagatacaattagcagcaagtgaaggattgcaaagg
gagcaatattatcatgaactgcttggtgaatatgaaaaaatctgctgtcttgtgaaagca
aaagatacttctgaaatgacagaagatgcagaagattatttacaaagtggtcaggatgaa
actgttctaggtaataagcaactagcagcaaataagcctgttgccaagggtcacggatgt
actagagctctgctaggaatagaaaaaatgaaggatatgatggtcttacaggatcaaatc
tcttttcttgagatttccccagtggctcaaaagcagctgaactcggatcaacagcatcag
gacgaagacttaccgcaaattgagagcgaaacagaagaaagattatgtgatgtagaacag
aggcatgaaagctttattacagaaactaaccagtacattagtaacttgcaagcagatatt
tcagcgcatcagaaatctattagaaaaacagttgctattattgagaaaaaggatatgcaa
ctgcagtctctgagagaaagactggaaaaccaacaaacagagcttcaggatttaaagacc
agtaataaattccttgaagattcagtaagacagctgaagctcatgtctgagatgtggggt
tcagagaagaaggacatgtcttcagtgatttgttcatatagcaaagaaattgaggaactt
actggagaaaatgcaacccttaaggatttaagcagagatttagaacaaaaccaaataact
ttactggaagcaaatagaaatatttctaatagtttaaaggaaaaagaagaaataatttct
gaaatgtccagaaagcataaggaggaaaaacaatgtatggaagcaagaactgaagaaatc
tcaagagagctgaaggttttgcaagcacagtataaactagtggaagaagaaaatgtaaat
gtgatgagcattctgagagaacagactgttgtatttgaggaaaagaaagcagaattagaa
caagaagaaaaattggtacttaacgaaaataaatatatattacataagctaatagcctct
gaagaaataaaaaagaatctgattcaagaacttcagcaactgcagtcaggtttttctgac
gttgaacgtgtgccctcacctgagcttgactgtttaaaacagggaatgtcaaatgtcaaa
gcaacacaaaatggaattcaagagcaacatggtactgtttgtatccaaggcagggaacaa
ttggtgaaggaactggaaacaaaaagtgaacctctagcatatgacttcagttgtgaaagg
aaggtttgttcagaccagttgaggaagatcatggaagaaaaggatacagagttgaataaa
taccaacttaatcttgagcttcttcacatggacttggaggacagggaggtctccctggag
aactacaggttagaagtgatgcaactaaagactgatttaaaaaagatggaaacagaactt
gagaaaagtgtgagagagaaagagacactgcagcaagaactgctgtctgttaaagaattg
aaagcttcatattctcagcttagattgctaagtgaagatagccagttggaggataatgat
gatgatgtttctcacaattgtggcaaaagaggaatggatgagtttgtcttgtcatcctct
ttgcaggtaataacaaacaaactgagtgaactggagaaaatctgtgagagattgcagaat
gagaatacagcatttgcttctccatttaaagattcaaaaactgatggcatcagagatatt
aataaaatggcagaggagaaggagaatattatcaatacaaatttgagaactgagaaagct
gcttttcaagatgaacttttggatcagagtgataacagtgatttgagaatggattgtggc
aataaggaaatatcattcagatttaaagaacacagtactggatccagttctgactatgaa
gacttaaaattgtccagtgaggaagttaaaatttactttgcggaaataaaggacaagttt
ttctctttccagaatgagcatatgaaattatatgaacagcactgtagtatggtatcaaag
ataatggagctacaatcttgtattaaaatactgagggcagaaaattctgcattgtcagca
agtatgagcagtgttcatttagattctctgagaattctactgtcttctagccaaaatgac
acacagtctaaattagatgaaactaagtctacagactctttactggatgttactttctca
gaagtaagtaaggttgataattcttgtaatggtggtgtgtgcaaatggacagacgaaatt
aatcagttgaaaaattctgtagaaggaatgtcagaagatgcagctaaagttttgattgaa
gatgatcatagcggccacatattggactctgttaaagagctcaggagtagtactcctagt
aaatataatcctgagggcagaatcaaagaacttgaaatgctatgtcagatatatgagaag
gtcatcaaggtgcttcaaaatcaacttcatattcaagagaatatgaaaactgaggaaata
caagagatgaaaaatatcatgctttctgagagaagagaaatagacaaactacaaaatctg
tctgataagaaagaatggcagcagaaactgaattacctgactacagagatggagtgcaaa
ttggcagaagaaggaaaaactaagaatctgtcttttgaccttaaaacagcaagtccccaa
ctacaagtccttaattcaggttctctctcactgccatgcactgatactgaaaataccact
cagaaaaaaaacaatactctttatcaactgggagtgcctgttggaaacccagcactgaga
aaaaataaaccaaaactaatccccgtggagaaaacggctgtaggagagacagctgtgcat
gaaaatactactgagaccacagaatcaaaattagtagaagctttttctaacaagtttcac
agaggagaagaatgtagaaatatgtcaggtaaaaataccagctcttcacatcatgatagc
gcactgtcattttctaatagcagtatatttttaagttcagaggatttctttgaaaatgaa
ataagcactgaaactcaccagaaagagataaaacaaaaaactattgaagatccaaagctg
atctatgctccagaaggccataaaaatgttgattttctcatggaagtcaaggaattaaac
tcacaggtggactttcagaatgcacagttaactctggagaactcaactttgattgaattg
gaagaaactgctgtagaaaaggaagaaaacagtggcataaaggaaaaactggaatcagct
tctgtcagtaaacagcaattatcttgtggagtagtgtctttaggaaaagaacctgagaaa
ataagtgctaagcataatgtaaataaaactgttttgtctaatacaactgacacactggat
gatattgaattgaccaagggaaactgccatgatctatttcttggagctgaaattgaacag
aggcagacaaaatctgagcaagttaatatggagacgcatgccttgtttgtggagggtaat
gctgaaattcttcaggcaaagtgtcagcagttagaaagggacagggaaattaacctgcaa
actattccttcaagccttcaagagcagctcgtttcagtcacagctgaaagaaatcatatt
ggtcaagaacagagtgttttgtcggaaaataaaaaagaattaggtcaagagtatcagaag
ctacaagagaaattaaaagagttagaaacaaataaggaggattctgccaaaacgattaga
agattagagagagaagtaaagatacaaacaaatctgcttgagactgcaaagtctgataca
gatcagctatcaggcgaaaaagatcaccttctacaaaacttgcaaagtttagaaaaggat
gccttgtctttcaggttggaagaagaaaaactccaaaaccaagtggcagatttgaacaag
gagaaagaggtgcttatgagagaatctgaaatgatgcagagtaaactgagtgcattggaa
attgaaaattcaaagctttccagatatttggacggcttgataacagaaaaacgtgaactt
gctgctagactgaactcagcgcagaaagaagtaaatcaaatgcgagaaggaatggagaag
ctgaaaataaaaattgaatctgatgagagaaaaaaacgccacattgctgaaaagctgaaa
gagaatgaacggaaatctgatgctcttttggataaagtagagaggcttgaaagagaattg
gagatgtcggaggaaaatctagaagatgcagttgttcaactggagactgcaaaggcagag
gcagagacatttataacagagaaggaagagatggctgagaagttgaaatgtcttcagtca
caaatcgatgatctcacctcacaaaaagagtgtttggctaaagattcaaaagagaagcaa
gaaaggatccttgaactggagtcttcaaatctgactacagcaaaacttttagaagaaaaa
gaggaagaaaagatgcaaatcaaggatgagtttgaaaatgctgtgttattgttgaaaagt
gagctcaaaggtatgagtgagaaattagagttttcttccaaggaggaagaatttgctaga
gcaaaagagcaagtcttgattaatcaggtggcttgtcttgagcaagataaaacaatgctg
ttacaggagtgtcaggaattaaaaaatgaaaatataaagttggatcacacaagggaacta
cttgctcaagaagttgtggaatataaacagaagctggaagaaaagatgcaggaaaatcat
gcgtttcaacagcagataaaagaaacagaggaactgtcttcacagttgacacgcatggaa
catgagcatgaatgctggcaccaggaaaaacaaaagctgcagaatttaattgttgagttg
aatctgaaggcacaacctttttctgatgatggaacctttccggatatcctgaatattcta
aaagtggcctataatgaccttgagaaggagctggaatctacactttgtgagaagactgct
ttatgtaaaaaggtaaatgagcagactgaaaattgtatcaagctggaagtcaagctaagt
gatgctgaacaggcgatttccaaattacaggaagaatttactatggagaggaagaagctt
gctgaacaaatacaactccttcaagaacattcagaacagaacaaaattgacttgcattta
gttgtgtcagaaaaacatgaactgacaaagagtttgggggcagttcagaaagaactacaa
gaaaaagaaaatataatgaaaagagaaatatcaaaataccaagacaaactacttcaaaca
gagaaagagcatcagaatgctttgaaggaagcaaacagaaagaatgaaatacaaattgag
gcctgtcaagaaaaggtgaattcattagaatgcttcatcagctcacaaaaattggagatt
gagcatttgaactcaactaaagaagaattaaataattctcttaaagaagctaatcagacc
ttaggagagctcctaaaacttaaggctgacaatattaacactatagttcaactaaacaag
gaaaaagaatttgtccagagcgaagtgcagctgtggattaaatcctgtaagcagatggaa
caggaaaaggaagtgctgcagaaacaactagctgactgtgaagaactactaaagaagaaa
gatctaagtactgatgagaatgccattacagaagaaattaagttagaactggaagaatta
caggaagctgtggaagtgaaaaccagagaggcaaatgagaacttggagaaatactgctct
ctaattgttaaatactataaacttgaggaagcaaatgagatgctaaaaatgcaagtcact
ttgttgaatggtcagctgaaacagcgaacaagtgatgctgtcagcagctctttgctgaat
tcaggtaactcatcaacagtaagcagtcagtctgacaaagagatgagatggaatgaagat
actactaagccttctactaaaagacagagatgtgaagacaccaggaaggacaacggagaa
ccaagatctcctttgccagagactagctcaaaaaaaaagaggaaggaggatatatgtcaa
aacttggagaatcaggagaactcagactatgagccagacgggcttccagaagtagttaaa
agaggttttgctgatatccccactgaaagggttagcccttatattttacgtagaaccacc
ctaaatctatggaccagtcctcatctggcttcccaaagtgagaacttgcccatacctaca
caacatgtacaaacaggaagatgggatcatcttggtgagcactcctactcaacacctggt
ggcagcaaatcacaaaagataaatgatgaacagcagtcccaagcaagaacagctttttca
ccaatgaaatcttctacaaggtcacctctttggccatataagcaatccacaaatattgtc
tctgacaacattagggagactcatatgattcacaaaggcaaagattcccaaaatgaacaa
gcactacccaagcaagatcaacaacaagaaaattgtaaggtgcagtaa

DBGET integrated database retrieval system