KEGG   Gallus gallus (chicken): 395360
Entry
395360            CDS       T01006                                 

Gene name
EIF2AK1
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    395360 (EIF2AK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    395360 (EIF2AK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395360 (EIF2AK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     395360 (EIF2AK1)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   395360 (EIF2AK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF641 SlyX Kdo APH DUF16 MetOD2 PKcGMP_CC TMF_DNA_bd DivIC
Other DBs
NCBI-GeneID: 395360
NCBI-ProteinID: NP_989979
CGNC: 2470
Ensembl: ENSGALG00000003391
UniProt: Q98SS6
Position
14
AA seq 635 aa
MWRGREVPPRAAAHRPPPAIQFPEESPEPRFDESDVPAELRVANGSQKFVNFTSTIQNQL
LLVSLLEHLCHMYTHNPVHSMCLFRILRQAFTRTGLLSPFAFCDEFSTVRLQHNRAITEL
MKAANRQVLNGELDNGDSRAIGEKEVLLEAQTSRYLNEFDEIARLGKGGYGQVYKVRNKL
DGQFYAIKKINIKKATRRDCMKVLREVKVLAGLQHPNIVGYHTAWMEHVQTACPKDKTVL
KLQSLPLEQESGDDHCHIQSVESGSSIIFADLTSQEEKSGDSTCLRNPDGESVQNMDVRN
DFTNSNSKEICMKPNRCELPIELQEDSDSSVDCRSTDLKHDSSYDPPCSLDLDASAGSKS
CTEECSGNDVALCGEFEVEYRLMLYIQMQLCELSLWDWIAARNKRCNERTEDAAGLYHLV
DVSWTMKIFEELLEGVCYIHSMGVMHRDIKPRNIFLHGSDHQVKIGDFGLACKDLLWDDA
DQWFHTERINGLTHTSGVGTCLYASPEQLQGSDYDFKSDMYSLGVTLLELFQPFGTEMER
AEVITNLRNGHIPHNFCKKWPVQAKYVKLLTSQVSTERPTAAQLRESELFHTTEHVISNL
QQKVREQEEEIEKLKEKLRLLSTGQDEHMEQGSPV
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtggcggggtcgggaggtgccccccagggccgcggcccatcgcccgccgcccgccatc
caattccctgaggagagcccggagccgcgcttcgacgagtcggacgtgccggcagaactg
cgagtggccaatgggtcacagaagtttgtgaatttcacttcgaccatccagaaccagctg
ctgctggtgtcgctgctggagcacctgtgccacatgtacacacacaaccccgtgcactcg
atgtgcttgttccgaatacttcgacaggctttcacgagaacaggtttgctctcccctttt
gccttctgtgatgaatttagtactgtaagactgcagcataatagagccattactgagcta
atgaaagcagctaaccgacaagtgcttaatggggagcttgataatggagattctcgtgca
attggggaaaaagaagttctcttggaagcacagacatcacgatacttgaatgaatttgat
gagattgcaagattaggaaaaggaggatatggccaagtatacaaggtcagaaacaagtta
gatggtcagttctatgctattaaaaaaatcaatattaagaaggctacaagaagagattgc
atgaaggtgctacgagaggttaaagtgctggctggactgcagcatcctaatattgtgggc
tatcacactgcttggatggaacacgttcaaacagcttgcccaaaggataagacagtattg
aagttgcagtcattacccttggaacaggagagtggagatgatcactgtcacattcagagt
gtggaaagtggtagttcaattatttttgctgaccttacttcacaagaagaaaagtctggt
gacagtacatgtcttagaaatccagatggtgaatcagtgcagaatatggatgtaaggaat
gatttcactaacagcaatagtaaggaaatatgtatgaaaccaaatagatgtgaattaccc
atagaactacaagaagactctgacagtagtgttgactgtagatcaactgatttaaaacat
gattcatcgtacgacccaccctgtagtctggatctagatgctagtgctggaagcaagtcc
tgcactgaagagtgctctgggaatgatgtagctctctgtggagagtttgaggtggagtat
cgtttgatgctttatatacagatgcaactgtgtgaactgtccctgtgggactggattgct
gcccgtaacaaaagatgcaatgagagaacagaggatgctgctggtctgtaccaccttgtg
gatgtcagctggacaatgaaaatttttgaagagttattagaaggagtgtgctatatccac
agcatgggagtgatgcatcgagacattaaacccagaaatatctttttgcatggatcagat
catcaagttaaaataggagattttggattagcctgcaaagacctcctttgggatgatgca
gaccagtggtttcacacagaaaggataaatggactgacacatacctcaggtgtggggact
tgcctgtatgcttcaccagaacagctgcaggggtctgactacgacttcaagtcagacatg
tacagcttgggtgttaccctgctagaactcttccagccatttggaacagaaatggaaaga
gcagaagttataacaaatttaaggaatggccacattcctcataacttctgcaagaaatgg
cctgttcaagccaagtatgtaaaacttctcaccagtcaggtatccacagaaagaccaact
gctgctcaacttcgtgaaagtgagctgtttcataccacagaacatgttatttctaatcta
cagcaaaaggtgagagagcaagaagaagaaatagaaaaactgaaagagaaactaaggctg
ctttctactggacaagatgaacatatggaacaaggttctccggtttaa

DBGET integrated database retrieval system