KEGG   Gallus gallus (chicken): 395386
Entry
395386            CDS       T01006                                 

Gene name
CLEC3B
Definition
(RefSeq) tetranectin precursor
  KO
K17520  C-type lectin domain family 3 member B
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:gga04091]
    395386 (CLEC3B)
Lectins [BR:gga04091]
 C-Type lectins
  Group 9: Tetranectin
   395386 (CLEC3B)
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R
Other DBs
NCBI-GeneID: 395386
NCBI-ProteinID: NP_989997
CGNC: 9007
Ensembl: ENSGALG00000030969
UniProt: Q9DDD4
Position
2
AA seq 201 aa
MALRGACLLLCLVSLAHISVQQNGKGRQKPAASKKDGVSLKMIEDLKAMIDNISQEVALL
KEKQALQTVCLKGTKIHLKCFLAFSESKTYHEASEHCISQGGTLGTPQGGEENDALYDYM
RKSIGNEAEIWLGLNDMVAEGKWVDMTGSPIRYKNWETEITTQPDGGKLENCAALSGVAV
GKWFDKRCKEQLPYVCQFMIV
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcgctgcggggagcctgcctgctgctctgcctcgtctccctcgcccacatctccgtc
cagcagaatggcaagggcaggcagaagccggcggcctccaagaaagatggtgtgagcctc
aaaatgattgaagacctgaaggccatgattgacaacatctctcaggaggttgctctactg
aaggagaagcaagcacttcagacagtctgcctgaaaggcaccaaaattcacctgaagtgc
ttcctggcgttctctgagagcaagacatatcacgaggccagcgagcactgcatctcgcag
ggcggcacgctgggcacgccgcagggtggagaggagaacgacgcgctctacgactacatg
cgcaagagcatcgggaacgaggcggagatctggctgggcctcaacgacatggtagccgag
ggcaagtgggttgacatgacgggtagccccatccgctacaagaactgggagaccgagatc
accacccagcccgatggcggcaagctggaaaactgcgcggccttgtcaggggtggcggtg
ggcaagtggtttgacaagcggtgcaaggagcagctgccctatgtctgccagttcatgatc
gtgtag

DBGET integrated database retrieval system