KEGG   Gallus gallus (chicken): 395388
Entry
395388            CDS       T01006                                 

Gene name
ATOH7
Definition
(RefSeq) protein atonal homolog 7
  KO
K09083  atonal protein 1/7
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395388 (ATOH7)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    395388 (ATOH7)
SSDB
Motif
Pfam: HLH DERM DUF1295
Other DBs
NCBI-GeneID: 395388
NCBI-ProteinID: NP_989999
CGNC: 2882
Ensembl: ENSGALG00000003931
UniProt: O57598
Position
6
AA seq 151 aa
MKTCQSSHLDSGVESDIQCRSGSGCVVKCSTERMESAAKRRLAANARERRRMQGLNTAFD
RLRKVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERYSTEREWINLHCEHFHPESY
HHYTGQKVATDSDPYAQRIFSYHPEHFQIAN
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaaacctgtcaatccagtcatttggattcaggagtagaatcagacatccagtgcaga
agtggatcaggctgtgttgtgaagtgcagcacagaaagaatggagagcgctgccaagaga
agactggctgccaacgccagggagagaagacggatgcaaggactgaacacagcctttgat
cgtttgaggaaggtggttccacagtggggtcaagataagaagctctccaaatatgagacc
cttcagatggctttgagttatatcatggctctaacacgaatacttgctgaagcagagaga
tacagtactgaaagagaatggattaaccttcactgtgaacactttcatccagagagctac
caccattatacgggacaaaaagtggcaacagacagtgatccttatgcacagcgaatattc
agctatcaccctgaacactttcaaatagctaattag

DBGET integrated database retrieval system