KEGG   Gallus gallus (chicken): 395389
Entry
395389            CDS       T01006                                 

Gene name
ALDH1A3
Definition
(RefSeq) aldehyde dehydrogenase family 1 member A3
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00830  Retinol metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    395389 (ALDH1A3)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     395389 (ALDH1A3)
SSDB
Motif
Pfam: Aldedh DUF1487 LuxC
Other DBs
NCBI-GeneID: 395389
NCBI-ProteinID: NP_990000
CGNC: 49294
Ensembl: ENSGALG00000033365
UniProt: Q9DD46
Position
10
AA seq 512 aa
MAAVNGAVENGPPDKKGPPLPRPLRGLEVKYTKIFINNEWHESTSGKKFPTYNPSTLEKI
CDIEEGDKPDVDNAVEAAKAAFQRGSQWRQMDALSRGRLLHKLADLLERDRVILATLETM
DTGKPFLQAYFIDLEGCIKTLRYYAGWADKIQGRTIPVDENFVCFTRHEPMGVCGAITPW
NFPLLMLVWKMAPALCCGNTLVIKPAEQTPLTSLYIGSLIKEVGFPPGVVNIVPGYGPTA
GAAISTHQSIDKIAFTGSTKVGKLIKEAASKSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFLNQGQCCTAASRVFVEEQIYPEFVKRSVEYAKKRLVGDPFDARTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGLAIEDRGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIM
KFKSIEEVIRRANNTEYGLTAAVFTKNLDRALTLASALQSGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLSQKSP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggccgcggtcaacggtgctgtggagaacgggccgcctgacaagaaggggccgccgctg
ccacggcctctgaggggtttggaggtgaagtacaccaagatatttataaacaatgaatgg
cacgagtctaccagtggaaagaagttccctacctacaatccctcgacgctagagaaaatc
tgtgatattgaggaaggagacaagcctgatgtggataatgcagtggaagcagcaaaggca
gcattccagagagggtctcagtggagacaaatggatgccttaagcaggggacggctccta
cacaaactggctgatcttctagagcgagacagagtcatcctggcaactttagaaacaatg
gacacgggaaaaccttttctgcaggcttatttcattgacctggaaggttgtataaagaca
ctccgatattatgctggatgggctgataaaatccagggcaggactatccctgtggatgaa
aactttgtctgtttcaccaggcatgaaccgatgggtgtttgtggagctataactccatgg
aacttcccattgctgatgctggtttggaagatggcaccggcgctgtgctgtggaaacact
ttggttattaaaccagctgaacaaactcctctcacatcactgtacattggctctctgatt
aaggaggtgggcttccctccaggtgtggtgaacattgtgccaggctatggccccacagct
ggagcagccatctctacccatcagagcattgataaaattgcttttactggatcaacaaag
gttggaaaactgatcaaggaagctgcttctaaaagcaacctgaaaagggtgacattagag
ctcggaggcaaaaacccctgcatcgtgtgtgcagatgcagacttggacttggcagtggaa
tgtgcccatcaaggtgtgttcttaaatcaggggcagtgctgcacagctgcctcacgagtg
tttgtggaagagcagatatatccggagtttgtcaagcgcagcgtggagtatgccaagaag
agacttgttggagacccctttgatgccagaactgagcaagggccccagattgaccagaaa
cagtttgataagatcctggagctgatagaaagtgggaagaaagaaggtgctaagctggag
tgtggtggtcttgccattgaagacagaggcctgtttataaaacccactgtgttttcagag
gtcaccgacaacatgcgcattgccaaagaagagatttttgggccagttcagcctattatg
aagttcaagagtatagaagaggtcataagaagagccaacaataccgagtatggactcaca
gctgcagtgttcacgaagaatctggacagagcattaacattagcttctgctttgcagtcg
ggaactgtctggatcaattgttacaatgctctgtatgcgcaggctccctttggtggcttt
aaaatgtcaggaaatggcagagaacttggtgaatatgctttggcagaatatactgaagtc
aaaacagtcaccattaaactgtcccagaagagtccatga

DBGET integrated database retrieval system