KEGG   Gallus gallus (chicken): 395391
Entry
395391            CDS       T01006                                 

Gene name
SNCB
Definition
(RefSeq) beta-synuclein
  KO
K24201  beta-synuclein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    395391 (SNCB)
Transporters [BR:gga02000]
 Other transporters
  Pores ion channels [TC:1]
   395391 (SNCB)
SSDB
Motif
Pfam: Synuclein DDOST_48kD
Other DBs
NCBI-GeneID: 395391
NCBI-ProteinID: NP_990002
CGNC: 14615
Ensembl: ENSGALG00000021542
UniProt: Q9I9G9
Position
13
AA seq 133 aa
MEVFMKGLSKAKEGVVAAAEKTKQGVAEAAEKTKEGVLYVGSKTQGVVQGVTSVAEKAKE
QASQLGEAAFSGAGNIAAATGLVKKEEFPADLKAEEVAQEAVEEPLVEPLLEPEGESYEE
SPQEEYQEYEPEA
NT seq 402 nt   +upstreamnt  +downstreamnt
atggaggtgttcatgaagggcttgtccaaggccaaggagggagtggttgccgccgccgag
aagaccaagcagggggtggctgaggccgccgagaagaccaaggaaggggtcctatatgtc
gggagcaaaacccaaggcgtggtgcaaggcgtcacctcagtggccgagaaggcgaaggag
caggcatcccagctgggcgaagcggcgttctcgggcgccggcaacatcgcggcggccacg
gggctggtgaagaaggaggagttccccgcggacctgaaggccgaggaggtggcccaggag
gctgtggaagagccgctggttgagccgctgctggagccggagggggagagctacgaggag
tccccgcaggaggaataccaggaatacgagccagaggcataa

DBGET integrated database retrieval system