KEGG   Gallus gallus (chicken): 395394Help
Entry
395394            CDS       T01006                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19 precursor
  KO
K22603  fibroblast growth factor 19
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395394 (FGF19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    395394 (FGF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    395394 (FGF19)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395394 (FGF19)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   395394 (FGF19)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   395394 (FGF19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 395394
NCBI-ProteinID: NP_990005
CGNC: 66203
Ensembl: ENSGALG00000028376
UniProt: R4GMB5
Position
5
AA seq 224 aa AA seqDB search
MGPRPAAPGAALALLGIAAAAAAARSLPLPDAGPHVNYGWGEPIRLRHLYTASKHGLFSC
FLRIGGDGRVDAVGSQSPQSLLEIRAVAVRTVAIKGVQSSRYLCMDEAGRLHGQLSYSIE
DCSFEEEIRPDGYNVYKSKKYGISVSLSSAKQRQQFKGKDFLPLSHFLPMINTVPVEVTD
FGEYGDYSQAFEPEVYSSPLETDSMDPFGITSKLSPVKSPSFQK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggggccgcgccccgccgcacccggcgctgccctggcgctgctggggatcgccgccgcc
gccgccgccgccaggtccctgccgctgcccgacgcgggtccgcacgtcaactacggctgg
ggggaacccatccggctgcggcacctctacaccgccagcaagcacgggctcttcagctgc
ttcctgcgcatcggcggcgacggccgggtggacgctgtcggtagccagagcccgcagagt
ctgttggagatccgcgccgtggcggtgcgcaccgtggccatcaagggtgtgcagagctcc
cgctacctctgcatggacgaggcggggcggctgcacgggcagctcagctattccattgag
gactgttcctttgaagaggagattcgtccagacggctacaacgtgtataaatcaaagaaa
tacgggatatcggtgtctttgagcagtgccaaacaaagacagcaattcaaaggaaaagat
tttctcccgctgtctcacttcttacccatgatcaacactgtgccagtggaggtgacagac
tttggtgaatatggtgattacagccaggcttttgagccagaggtctactcatcgcctctc
gaaacggacagcatggatccctttgggatcacttccaaactgtctccagtgaagagcccc
agctttcagaaatga

DBGET integrated database retrieval system