KEGG   Gallus gallus (chicken): 395396
Entry
395396            CDS       T01006                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a isoform 1 precursor
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    395396 (WNT3A)
   04150 mTOR signaling pathway
    395396 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    395396 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395396 (WNT3A)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Morphogens
   395396 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 395396
NCBI-ProteinID: NP_001165072
CGNC: 49296
Ensembl: ENSGALG00000042657
UniProt: Q2LMP1
Position
2
AA seq 352 aa
MASFGYFLFLCGLSQALSSYPIWWSLAIGHQYSSLGTQPILCGSIPGLVPKQLRFCRNYV
EIMPSVAEGVKIGIQECQHQFRGRRWNCTTVNDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSATICGCDTRHKGSPGEGWKWGGCSEDVEFGSMVSREFADARENRPDAR
SAMNRHNNEAGRTSIIELMHLKCKCHGLSGSCEVKTCWWSQPDFRVIGDYLKDKYDSASE
MVVEKHRESRGWVETLRPKYNFFKAPTEKDLVYYENSPNFCEPNPETGSFGTRDRICNVT
SHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVRCQECIRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggcctcttttggatatttcctgtttctctgtgggttgagtcaggctctgtcaagttac
ccaatctggtggtccttggcgattggtcaccaatattcctctctggggactcagcccatc
ctctgtgggagcatcccaggactggtccccaagcagctacgattctgtcggaactatgtg
gagatcatgcccagcgtagcagaaggggtgaagattgggatccaagagtgccaacaccaa
tttcgagggaggaggtggaactgcacaactgtcaatgacagcttggccatcttcggacct
gtgctagacaaagctaccagggaatccgccttcgtccatgccatcgcctctgccggagtg
gcttttgcagtgaccaggtcctgcgccgagggctcggccaccatctgcggctgtgacact
cgtcacaagggatctccaggggaaggctggaaatggggaggctgcagtgaggacgtggag
tttgggagcatggtgtctcgggaattcgccgatgcccgagagaacagaccagacgctcgg
tcagccatgaacaggcacaacaatgaagctggaaggacctctatcattgaactcatgcat
ctgaagtgcaaatgtcacggcctctcgggcagctgtgaagtgaagacctgctggtggtct
cagcctgacttcagggtcatcggggactacctgaaggacaaatacgacagcgcttcagaa
atggtggtggaaaaacaccgggaatcccgtggttgggtcgagaccctcaggcccaaatac
aacttcttcaaggctccgactgagaaggacctggtttactatgagaactcacccaacttt
tgcgagcccaaccctgagacgggttccttcgggactcgtgacaggatctgtaacgtcact
tcccatgggattgacggttgtgaccttttgtgctgcggccgcgggcacaacacgaggact
gagaaacggaaagagaagtgccactgtatcttccactggtgctgctacgtccgctgccag
gaatgcatacgagtctacgatgtccacacgtgcaaataa

DBGET integrated database retrieval system