KEGG   Gallus gallus (chicken): 395397
Entry
395397            CDS       T01006                                 

Gene name
CDX1
Definition
(RefSeq) homeobox protein CDX-1
  KO
K09312  homeobox protein CDX1/4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395397 (CDX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Cad
    395397 (CDX1)
SSDB
Motif
Pfam: Caudal_act Homeodomain Homeobox_KN YdaS_antitoxin
Other DBs
NCBI-GeneID: 395397
NCBI-ProteinID: NP_990007
CGNC: 4232
Ensembl: ENSGALG00000005679
UniProt: Q9DEB6
Position
13
AA seq 260 aa
MYVGYLLDKDTNMYPSPVRHPSLNLNPQNYVPGPPQYSDFASYHHVPGINNDPHHGQPAA
AWGSPYTPAKEDWHSYGTAAASAATNPGQFGFSPPDFNPMQPHAGSGLLPPAISSSVPQL
SPNAQRRTPYEWMRRSIPSTSSSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKA
ELAAALGLTERQVKIWFQNRRAKERKVNKKKLQQQSQPTSTTTPTPPAVGTPGPMGTLCS
GSAPSLVSSSPLTIKEEFMP
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtatgtaggctatcttttggataaggacaccaacatgtatcccagtcccgtccggcat
cccagcctcaacctcaacccccagaactacgtgccggggccaccccagtactcggacttc
gccagctaccaccatgtgccagggattaacaacgaccctcaccatgggcagcccgcagcc
gcctggggctcaccctacacccctgccaaggaggactggcactcatatggcaccgctgcc
gcctccgccgccaccaacccagggcagtttggatttagccccccggattttaaccccatg
cagccccatgcgggctctggactcctgcctccagccatcagcagctcggtgccacagctg
tcccctaatgcacagaggcgcaccccgtacgaatggatgaggcgcagtattcccagcacc
agcagcagcggcaagacgaggacaaaggacaagtaccgggtggtgtacacggaccaccaa
cgcctggagctggagaaggaatttcactacagccgctacatcaccatccgccgtaaggcc
gagctggctgctgccctggggctcactgaacggcaggtgaaaatctggtttcagaaccgg
agggcgaaagagaggaaggtgaataaaaagaagctgcagcagcagagccagcccaccagc
accaccacgccaacccccccagccgtgggcacgccagggcccatggggaccctctgcagt
ggcagtgccccaagccttgtctcctcatctccgctcaccatcaaggaggagttcatgcct
tag

DBGET integrated database retrieval system