KEGG   Gallus gallus (chicken): 395399
Entry
395399            CDS       T01006                                 

Gene name
CITED2
Definition
(RefSeq) cbp/p300-interacting transactivator 2
  KO
K21361  Cbp/p300-interacting transactivator 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    395399 (CITED2)
SSDB
Motif
Pfam: CITED
Other DBs
NCBI-GeneID: 395399
NCBI-ProteinID: NP_996726
CGNC: 49298
Ensembl: ENSGALG00000013818
UniProt: Q9DDW4
Position
3
AA seq 236 aa
MAEHMMAMNHGRFPDGAGGLHHHPAHRLGMGQFAAPHHHQHQQQQPHAFSALMGDHIHYG
AGNMNASGGVRHAMGPGGVGGGHPAGSMPPPARFSGSQFMAAPVGSPGGQLSASMQLQKL
NNQYFSHHPYPHGHYVPDLHPGGHPLSGGGQHFRDCNPKHGGGGSGLPPAVPHVPAAMLP
PNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcggaacacatgatggccatgaaccacgggcgattccccgacggcgccggcgggctc
caccaccaccccgcgcaccggctgggcatggggcagttcgccgccccccaccaccaccag
caccagcagcagcagccgcacgccttcagcgccctgatgggagaccatatacattacgga
gcgggcaatatgaacgcgagcggcggggtccggcacgccatggggccgggcggcgtggga
ggggggcacccggccggcagcatgccgccccccgcccgcttcagcggctcccagttcatg
gccgcccccgtgggcagcccgggagggcagctgagcgccagcatgcagctgcagaagctc
aacaaccagtacttcagccaccacccgtacccgcacggccactacgtgccggacttgcac
cccggcggccacccgctgagcggcggcggacagcatttcagggactgcaaccccaagcac
ggcggcggaggcagcggcttgccgcccgccgtgccccacgtccccgcggcgatgctgccg
cccaatgtcatagacactgacttcatcgacgaggaggtcctcatgtccttagtcatcgaa
atggggctggatcgcatcaaggagctgccggagctgtggttgggacagaacgagtttgac
ttcatgacggacttcgtttgcaaacagcagcccagcagggtgagctgctga

DBGET integrated database retrieval system