KEGG   Gallus gallus (chicken): 395400Help
Entry
395400            CDS       T01006                                 

Gene name
BAZ2B
Definition
(RefSeq) bromodomain adjacent to zinc finger domain protein 2B
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain MBD WSD PHD DDT BUD22 WHIM1
Motif
Other DBs
NCBI-GeneID: 395400
NCBI-ProteinID: NP_990008
CGNC: 9548
Ensembl: ENSGALG00000012579
UniProt: Q9DE13
Position
7
AA seq 2130 aa AA seqDB search
MESGERLTSSSVSSTAAASSPVSSTPSVASAVSKSGLTTGAASLSSTINTGEWWRTADSH
SRSGAAFFPPLLGPPLLGISPLFAPPAQNHDSTPFHPRTTGKNNRGSLEKGINGSLNGNS
TTAASAISTSVLSTSIATSAGQVKVVTSGAGGRKYNQEQNKVQLLDTRADKIKDKKPRKK
AVESSSNSDSDSGSSSDTSSEGISSSDSDDLEEDEEEEEDQSAEESEDDESDSENEAHHE
NKNKVLMHSGVKDMKTDGQKAHEKSQEKRTHQQIPLVSDSQTHSSFQSQQKQPQVLSQQL
PFIFQSSQAKEESVNKHTSVIQSTGLVPNVKPLSLVHQTKKEAYLKIIVPPPDLLKAGNK
NTSEESIPLISDVRSKREQYKQTFPAAQLKKQESSKNLKKVIASLSSSKPTSCSPAHQKL
TSLENNHSNPFLTNALLGNHQPNGVIQSVIQEVPLALTTKQKSQTKINESVAIASSTPFS
LPVNLSACGKKTTGNRTLVVPSTSPVLPGSGKDKPVSNNAVNAVKTQHCLPSAKLVVEQF
RGVDSDAPSSKESDDSNDDDDDDEDEDEDDEDDDSDDSQSESDSNSESDTDGSEDEDDED
DKDQDESDTDTEGEKTPLKLKKTGSSIKSSSIGPVAHSTPLNLQVAKTPSSAPSALCPET
QPAVFLGTTPSTLTPSSHCGISKRRRVTDERELRVPLEYGWQRETRIRNFGGRLQGEVAY
FAPCGKKLRQYPEVVKGVQWCLLKEEEVVPCIRAMEGRRGRPPNPDRQHSREESRMRRRK
GRPPNVGSTEFLDSTDAKLLRKLQAQEIARQAAQIKLLRKLQKQEQARAAKEAKKQQAIM
AAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELRAQQILEAKKKKKEEAANAKLLEAEKR
IKEKEMRRQQAVLLKHQELERHRLDMERERRRQHMMLMKAMEARKKAEEKERLKQEKRDE
KRLNKERKLEQRRLELEMAKELKKPNEDMCLADQKALPELPRIPGLVLSGSTFSDCLMIV
QFLRNFGKVLGFDVNTDVPSLSTLQEGLLNIGDSRGEVQDLLVKLVTAAVCDPGLVTGYK
AKTILGEHLLNVGINRDNVSEILQIFMEAHCGQTELTESLKTKAFQAHTPAQKAAVLAFL
VNELACSKSVVSEIDKNIDYMSNLRRDKWMVEGKLRNLRIIHAKKTGKRDATGGGEVGEE
PHSLETPTPGRKRRRKGGDSDYDDDDDDDSDDQADEDDEDEEDKEDKKGKKAEVCEDEDD
GDQTVSVEELEKQIEKLTKQQSQYRKKLFEASHCLRSMMFGQDRYRRRYWILPQCGGIFV
EGMESGEGLEEIAKEKEKLKKVESIHIKEEVFEISEEKISCLNTTRCEQKEDLKEKDNTN
LFLQKPGSFSKLSKLLEVAKMPPECDVMPQKPNGGAANGCTPSYQNTSQNSLCSLQPSVS
QSSSEKSDSSNLFSPTASGTGKFYSSPLIPSDQLLKTLTEKNRQWFSLLPRVPCDDMSVT
HVDTPATTSLTPQSHPPSKSPSPVPSPLLGSTSAQSPMGLSPFAMPPLQQMKPGLPVMGL
QFCGWPTGVLTSNVQFSSPLPTLGSGLGLSEGNGNSFLTSSVPTSKSESPALQTEKVAFA
TCTAVEVAKPVDHPNPKPIPEEMQYGWWRITDPEDLKSLHKVLHLRGIREKALQKQIQKH
MDYITLACIKNKDVAIIDINENEDNQVTRDVVENWSVEEQAMEVDLAILQQVEDLERRVA
SASLQVKGWLCPEPASEREDLVYHEHKSIIRLHKKHDGDSAGGGEGSTSSLERKNDNPLD
IAVTRLADLERNIERRYLKSPLSTTIQIKLDNVGTVTVPAPAPSISGDGDGTEEDIAPGL
RVWRKALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGC
HTYCHRPKITTIPDGDWFCPACIAKASGQTLKLKKLQIKGKKSNEQKRGRKLPGDTEDED
SATTSTSLKRGKTEPKKRKMDESVSVSQGKQENFTAIKKPKRDDSKDLAICSMILSELET
HEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIRDKLTSGQYPNVEAFSLDVRLVFDNCET
FNEDDSDIGRAGHNMRKYFEKKWTEIFKLS
NT seq 6393 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggagagcggttaacgtcgtcatcagtctcttcaactgcagctgcttcatct
ccagtgtcttctacaccttctgtagcttctgcggtttccaagagtggccttaccactgga
gctgcgtcgttgagttccacaatcaacacgggtgaatggtggcgaacagcggactctcac
tctcgttctggggcagcttttttcccaccactcttgggcccaccactcttgggcatctca
ccgctctttgcacctcctgcccaaaaccatgattctactccattccacccaagaactaca
ggaaaaaataatcgtggcagtttagaaaaaggtataaatggatcactgaatgggaacagt
accactgcagcatctgctatcagcacatctgtactgtccactagtattgcaacatccgca
gggcaagtgaaagtggtaacctcaggagcaggaggccgcaaatacaaccaggagcaaaac
aaagttcagcttttggacaccagagctgacaaaattaaagacaagaaacccagaaaaaaa
gcagtagaaagctccagtaacagtgacagtgactcaggctcctcgtcagacacatcgagt
gaaggcataagcagcagtgattctgatgacctagaggaggatgaagaggaggaggaggac
cagagtgctgaagagagtgaagatgatgaatctgattctgaaaatgaagcacatcacgaa
aacaagaacaaggtgctaatgcatagtggtgtaaaagacatgaaaactgatggccaaaaa
gcccatgaaaagtcccaagaaaaaagaacacaccagcagatacctcttgtgtctgattcc
cagactcattcatcattccagtcccagcagaagcagcctcaggttttgtcacagcaactt
ccgtttattttccaaagctctcaggcaaaggaggaatctgtgaacaaacacacaagtgta
atacagtctacgggactggttcccaatgtgaaacctttgtctttggtacatcaaaccaaa
aaggaagcctacttaaaaatcatagttcctcctcctgacctactcaaagcagggaataag
aatacctctgaagaatccatacctttgatcagcgatgtacgatcaaaacgagaacaatat
aaacagacattcccagcagcacagctaaagaaacaggaatcatctaagaacctgaagaag
gttattgcatctttgtcaagctcaaaaccgacatcttgttcaccagctcatcaaaaactc
acatctttggaaaacaaccattctaatccattcctgacaaatgcacttttaggtaatcac
caacccaatggagttattcagagcgtcatccaggaagttcctcttgcacttactacaaaa
cagaaatcccaaaccaagatcaatgaaagtgtagccattgctagcagtacccccttttct
ttgccagtgaacttgagtgcatgtgggaaaaaaacaactggtaaccggacacttgttgtg
ccctctacctctcctgtgttacctggttcaggaaaggataaaccagtcagcaataatgca
gtaaatgcagtaaaaacacaacactgccttccgtctgcaaaactggtggtggagcagttc
agaggggtagactcagatgcccccagcagtaaagaatctgacgactcaaatgatgatgat
gacgacgatgaagatgaagatgaggatgatgaagatgatgattctgatgatagccaatca
gagtctgacagtaattccgagtcagatacagatgggtctgaagatgaagatgatgaggat
gataaggatcaagatgagtcagatacagacactgagggggaaaaaactccactgaaactt
aagaaaactggttcctccataaagagctcttccattggtcctgtagctcattccactccg
ctaaatctccaagtagcaaagaccccgagctctgcaccatctgccttatgtcccgagacc
cagcctgcagtttttcttgggacaacaccatctactcttacaccaagttcacactgtggc
atctcaaagagacgaagagtaacagatgaacgggagctgcgtgttcctctggaatatggc
tggcaaagagaaacccgaataagaaactttggtggccgtcttcagggagaagtagcgtat
tttgcaccttgtggaaagaagctgaggcaatatcctgaagtagtaaagggcgtgcagtgg
tgtcttctgaaggaggaggaagtcgttccctgcatcagagctatggaagggcgtagagga
cgaccaccaaatccagacaggcagcattctagagaggagtcaagaatgagacgtcgcaaa
ggccgacctccaaatgttggaagcactgaatttctagacagcactgatgcgaagctttta
agaaagctacaggctcaagaaatagctagacaagcagcacaaataaagctactgagaaaa
ctccagaagcaggaacaagcccgagctgccaaagaagcaaaaaaacagcaagctattatg
gcagctgaagaaaagcggaagcaaaaagagcagataaagataatgaagcagcaggaaaag
attaagcggatccagcaaatcagaatggagaaagaacttcgagctcaacagattttagag
gcaaaaaagaagaagaaagaagaagcagcaaatgctaaattactggaggctgaaaaacga
ataaaggaaaaagagatgcgaaggcaacaagctgttcttctcaagcaccaggagttggag
aggcatagactagatatggaacgagagaggagaagacagcatatgatgcttatgaaagcc
atggaagcacgtaaaaaggcggaagaaaaagagcgattaaagcaagagaaacgtgatgaa
aaaaggttaaataaagaacgtaaactagaacagcgaagactggaactagaaatggcaaag
gagctgaagaagcctaatgaagatatgtgcttagcagaccagaaggctttgccagagctg
cctcgcatcccaggccttgttctgtctggaagcacattttcagattgtctcatgatagta
cagttcttgcgtaactttggtaaagttcttggctttgacgtgaatacagatgtgccttcc
ctgagtactcttcaagaaggtttgctgaacataggggacagcagaggagaagtacaggac
ttgcttgtaaagcttgtcactgcagctgtttgtgatccaggacttgttacaggatacaag
gctaaaactattcttggggagcacttactgaatgttggcatcaatcgagataacgtgtct
gagattttgcagatatttatggaggctcattgtgggcaaactgagcttacagagagcttg
aagacaaaagcttttcaggcacatactccagctcagaaagcagcagtgctagctttcctt
gtcaatgagttagcttgcagcaaaagtgtagtcagtgaaattgataaaaatattgattat
atgtcgaacttgaggagagataaatggatggttgaaggcaaacttcggaatcttagaatc
attcatgccaaaaaaactggcaaaagagatgctacaggaggtggtgaagtaggagaggag
ccgcattctttggaaacaccaacaccaggccgcaaacggagacgaaagggtggggatagt
gattatgatgatgatgatgacgatgatagtgatgatcaggcagatgaggatgatgaggat
gaagaggacaaagaagataaaaaaggaaagaaggcggaagtttgtgaggatgaggatgat
ggagaccagacagtgagtgttgaagaactagagaagcagattgaaaaactgacaaagcaa
caaagccagtacagaaagaagttatttgaagcctcacattgtttgcgttcaatgatgttt
ggtcaagatcgttacaggcgccggtattggattctgccccagtgtggtggcatttttgta
gaaggcatggaaagcggtgaaggtttagaagaaattgcaaaagaaaaggagaagttaaaa
aaagtagaaagtatacatatcaaagaagaggtatttgagatctcagaagaaaaaataagc
tgtttaaatacaactcgctgtgagcaaaaggaagatctgaaagaaaaggacaacactaat
ttgtttttgcaaaagcctgggtcattttcaaaactaagcaaactgttagaggttgcaaaa
atgccacctgagtgtgatgttatgccccaaaaacctaatggtggtgcagcaaatggatgc
actccatcttatcaaaatacttcccaaaactctctgtgtagtcttcaacccagtgtatca
caaagcagcagcgaaaagtctgattctagtaatcttttcagtcctactgcaagcgggaca
ggaaagttttatagttctccattaattccaagtgatcagttattaaagactcttactgag
aagaacagacagtggttcagccttctgccaagagtaccctgtgatgacatgtcagttacc
catgtagatacaccagctactacgtcacttactcctcaatcgcatccaccatcaaaatca
ccatcacctgttccatcacctcttctgggctcaacctctgcacagagtccaatgggatta
agtccttttgcaatgccaccgctgcagcagatgaagcctggactacctgtcatgggactt
cagttttgtggatggcctacaggagttcttacttcaaatgttcagttttcatctccttta
cctactcttggatcagggttgggattatcagaagggaatggtaactcattcttgacatct
agtgttcctacaagtaaaagtgaatcaccagcactgcagactgagaaagtagcttttgcc
acctgtacagcagtggaagtggccaagccagtagatcacccaaacccaaaaccaatacca
gaagaaatgcagtatgggtggtggaggattactgatcctgaggacctaaaatctttgcat
aaagtgctgcatctcaggggaataagagaaaaggccttacaaaaacaaatacagaaacac
atggactatatcactctggcctgcatcaaaaataaggatgttgcaattattgatatcaat
gaaaatgaagataaccaggtaactcgagatgttgtggaaaactggtcagtagaagagcaa
gcaatggaggtggaccttgctattcttcagcaggtggaagacctagagaggagagttgca
tcagctagtttgcaagttaagggctggctgtgtcctgaacctgcatcagaaagagaagac
ttggtatatcatgaacataagtcaattattagattgcacaagaaacacgatggagatagt
gctggaggcggagaaggcagtaccagctctctagagcggaagaatgacaaccctctagat
atagctgtaaccagacttgctgacttggagcggaacatagagcgaaggtatctgaagagc
cccttaagtaccaccattcagatcaaactggataatgtgggcacagttactgtccctgct
cctgcaccatccattagtggtgatggtgacggaactgaagaggatattgctccagggctg
agggtatggagaaaggcgttgtcagaagcacgaagtgctgcacaggtagctctgtgcatt
cagcagttacagaaatcgatagcatgggaaaaatctattatgaaagtttactgccaaata
tgtcgaaagggagataatgaggaactgctgctgctttgtgatggttgtgataaaggctgt
catacctactgccacagacccaagatcactaccataccagatggtgactggttttgtcct
gcctgcatagcaaaggcaagtggtcaaactctaaaattaaaaaaacttcaaataaaagga
aaaaaaagtaatgaacaaaagagaggcaggaaattaccaggagatacagaagatgaagac
tctgcgactactagtacctcattaaaaagagggaaaacagaacctaagaaaaggaaaatg
gatgaaagtgtttctgtaagccaaggaaaacaagaaaatttcactgctataaagaaacct
aaaagagatgactccaaggacctggctatatgcagcatgattctctcagaattggaaact
catgaggatgcttggcctttcttacttcctgtaaacttgaaacttgttcctggttataag
aaagttattaaaaagcctatggacttttccacaattagagacaagctaactagtggacag
taccccaatgttgaagcattttcgctagatgtcaggcttgtttttgacaactgtgaaacc
tttaatgaagatgattctgacataggcagggctggccacaacatgaggaaatattttgaa
aaaaaatggacggagattttcaaattgagctga

DBGET integrated database retrieval system