KEGG   Gallus gallus (chicken): 395403
Entry
395403            CDS       T01006                                 

Gene name
TRA2B
Definition
(RefSeq) transformer-2 protein homolog beta
  KO
K12897  transformer-2 protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    395403 (TRA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    395403 (TRA2B)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    395403 (TRA2B)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     395403 (TRA2B)
Spliceosome [BR:gga03041]
 Common components
  Common spliceosomal components
   SR proteins
    395403 (TRA2B)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_3 Apt1
Other DBs
NCBI-GeneID: 395403
NCBI-ProteinID: NP_990009
CGNC: 49299
Ensembl: ENSGALG00000006531
UniProt: Q9DDU8
Position
9
AA seq 289 aa
MSDSGEQNYGERESRSASRSGSAHGSGKSGRHTPARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHIGNRANPDPNCCL
GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVEDAKEAKERAN
GMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSY
RGGGGGGGGGWRAVQDRDQFYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
NT seq 870 nt   +upstreamnt  +downstreamnt
atgagcgacagcggggagcagaactacggcgagcgggaatcccgttctgcttccagaagc
ggaagtgctcatgggtctggcaagtcggggaggcacacccctgcaagatctcgatctaag
gaggattcaaggcgttccaggtcaaaatctagatccaggtctgaatccagatctagatca
aggaggagttcccgcaggcactacaccaggtcacgctctcgttcccgctctcacagaaga
tccagaagtaggtcgtacagtcgggattatcggcgacgacacagtcacagccattcaccc
atgtctactcgcagacgccacattggaaacagggcaaatcctgatccaaattgttgtctt
ggtgtgtttgggttgagcttgtacaccacagaacgagatctgagggaagttttctccaag
tatggtccaattgctgatgtttccattgtgtacgatcagcagtctcgacgttcaagggga
tttgcatttgtgtactttgaaaacgttgaggatgctaaggaagctaaggaacgtgccaat
ggaatggagttggatggaagaagaatccgggtagacttttccataacaaaaagacctcac
acacctacccctggaatctacatgggaagacccacttatggcagctcacggcgacgggat
tactatgacagaggatatgataggggatatgatgatcgtgactattacagcagatcatac
agaggaggcggtggcggtggaggaggaggatggagagctgttcaagacagagatcagttt
tacaggaggagatcaccgtccccatattacagccgagggggctacagatctcgatccaga
tctcgatcctattcacctcgtcgctattaa

DBGET integrated database retrieval system