KEGG   Gallus gallus (chicken): 395413Help
Entry
395413            CDS       T01006                                 

Gene name
KAT5
Definition
(RefSeq) histone acetyltransferase KAT5 isoform X1
  KO
K11304  histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     395413 (KAT5)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    395413 (KAT5)
   HAT complexes
    TIP60 complex
     395413 (KAT5)
    NuA4 complex
     395413 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_7 Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 395413
NCBI-ProteinID: XP_015128510
CGNC: 49306
Ensembl: ENSGALG00000035748
Position
33
AA seq 628 aa AA seqDB search
MMAAVGDGGGVGGAGGALRAPPPPPPVQSRRFRKCRRHVSKAAGKATPLPPYGSAASALR
SAMRMRNRKRAEKGRKWVEREEEALWAPSGSGALHPEAACGEMAEAAEVSEGCRLPVLRR
NQDNEDEWPLAEILSVKDISGRRLFYVHYIDFNKRLDEWVTPERLDLQRVQGPRKEAKTP
TKNGLPGSRPDSPERDPRKSLELALAPASGKSLPGPPGPPGPPGPPGPAGLGPGPLPLTL
RFHLPQDSVAEPPPAPQRPTKRKVEVVSPATPVPAATETSQASVFPQNGSARRAVAAQPG
RKRKSACLGTDEDSQDSSDGAPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPW
YFSPYPQELTALPVLYLCEFCLKYGHSLRCLQRHLTKCDLRHPPGNEIYRKGTISFFEID
GRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDY
NVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEI
LMGLKAEGGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSGDIVEGHE
RAMLKRVLRIDAKCLHFTPKDWSKRGKW
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcggtgggagatgggggaggggtgggcggggccgggggcgctctccgcgct
cctccgccaccgccgcccgtgcagagccgccgcttccggaagtgccgccgtcacgtgagc
aaggctgccgggaaggccacgcctcttccgccttatggcagcgcggcctccgccctgcgt
tcggctatgcgcatgcgcaatcggaagcgggcggagaaggggcggaagtgggtggagcgc
gaggaggaagcgctctgggcgccgagcggaagtggcgcactgcacccggaagcggcctgc
ggggagatggcggaggcggccgaggtgtcggagggctgccgcctgcccgtgctgcgccgt
aaccaggacaacgaggatgagtggccgttggccgagatcctgagcgtgaaggacatcagc
ggccgccgcctcttctacgtccattatatcgactttaataaacgtctggacgaatgggtg
acccccgaacgcctggacctgcagcgggtgcagggaccccgcaaagaagccaagaccccc
accaagaacggcctgcccggctcccggcccgactcacccgaacgtgacccgaggaagagt
ctggagctggcgctggcccccgccagcgggaagagcctgccagggccaccggggccacca
gggccaccagggccaccggggccagcggggttggggccggggccgctgcccctcaccctc
cgcttccatctgccccaggacagcgtggccgagccccccccggccccgcagcgtcccacg
aagcgtaaagtggaggtggtctcacctgccacccccgtccccgcggccaccgaaacctcg
caggcatccgtcttcccccagaacggctcagcacgccgcgccgtggccgcccaaccgggg
cgtaagaggaaatcagcgtgcctggggactgatgaggactcccaggactcctcggatggt
gctccctctgccccccgcatgacgggcagcctggtgtcggaccgcagccacgacgacatc
gtcaccaggatgaagaacatcgaatgcatcgagctgggcaggcaccgcctcaagccctgg
tatttctcaccctacccccaggagctgacggctctgcccgtcctctacctctgtgagttc
tgcctcaagtacggccacagcctgcgctgcctccagaggcatttgaccaaatgtgacctc
cggcaccccccgggcaatgaaatctatcgcaaaggcaccatttcctttttcgagatcgat
ggccgcaaaaacaagagttactcacagaacctgtgcctgttggccaagtgcttcctggac
cacaaaacactttactacgacaccgatcctttcctcttctatgtcatgactgagtacgac
tgcaagggcttccacatcgttggctatttctccaaggagaaagaatcgacagaggattac
aacgtggcgtgcatcctgacactgcccccctaccagcgtcggggttatggcaagctgctc
atcgagttcagttatgagctgtccaaagtggaggggaagacggggacccccgagaagcca
ctgtcagacctggggctgctgtcgtaccgcagctattggtcacaaaccatcctggagatc
ctgatggggctgaaggctgaggggggggagcgaccccagatcaccatcaatgagatcagc
gagatcaccagcatcaaaaaggaggacgttatctccacgctgcagtacctcaacctcatc
aactactacaagggccaatacatcctgacgctgtcgggggacatcgtggagggccacgag
cgcgccatgctgaagcgggtgctgcgcatcgacgccaagtgcctccatttcacccccaag
gactggagcaagaggggcaagtggtga

DBGET integrated database retrieval system