KEGG   Gallus gallus (chicken): 395414
Entry
395414            CDS       T01006                                 

Gene name
CCT4
Definition
(RefSeq) T-complex protein 1 subunit delta
  KO
K09496  T-complex protein 1 subunit delta
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    395414 (CCT4)
   03036 Chromosome and associated proteins [BR:gga03036]
    395414 (CCT4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395414 (CCT4)
Chaperones and folding catalysts [BR:gga03110]
 Heat shock proteins
  HSP60 / Chaperonin
   395414 (CCT4)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    395414 (CCT4)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   395414 (CCT4)
  Exosomal proteins of colorectal cancer cells
   395414 (CCT4)
  Exosomal proteins of bladder cancer cells
   395414 (CCT4)
SSDB
Motif
Pfam: Cpn60_TCP1 Phage_tail_X
Other DBs
NCBI-GeneID: 395414
NCBI-ProteinID: NP_996761
CGNC: 6688
Ensembl: ENSGALG00000008812
UniProt: Q9I8D6
Position
3
AA seq 536 aa
MPENAGPKAHGGAGNRAKGTYQDRDKPSQIRFSNISAGKAVADAIRTSLGPKGMDKMIQD
AKGDVTITNDGATILKQMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACSRL
LQKGIHPTIISESFQKALEKGIEVLTNMAQPVELSDRETLLNSATTSLNSKVVCQYSSLL
SPMSVDAVMKVIDPSTASSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVANTGVTRVEK
AKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKAGCNVLLIQKS
ILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTPDMLGSAELAE
EVNLNGSGKLIKITGCTNPGKTVTIVVRGSNKLVLEEAERSIHDALCVIRCLVKKRALIA
GGGAPEIELALRLNEYARTLRGMDSYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNR
HAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgccggagaacgcgggacccaaagcccacggaggcgccgggaatcgggccaagggcacg
taccaggaccgggacaagccctcccagatccgcttcagcaacatttccgccggcaaagct
gtcgctgatgctatcaggacgagccttggaccaaaaggaatggataaaatgattcaggat
gctaaaggagatgtgacaatcactaacgatggtgctactatcctgaaacaaatgcaggtt
ttgcaccctgcggccaaaatgttggtagagctgtcaaaagcacaagatattgaagctggg
gatggtactacgtctgttgttgtcattgccggagctcttctggatgcctgttccagactt
cttcagaaaggaattcaccccaccatcatctcagagtcattccagaaagctttagagaaa
ggtattgaagtattgaccaacatggcacagccagttgaactgagcgacagagaaaccctg
ctaaacagcgcaaccacttcgctgaactcgaaggttgtgtgtcagtattccagtttactt
tctcccatgagtgtggacgcagtgatgaaggtgatagacccatctacagctagcagtgtg
gacctcagagatattaaaattgtgaagaagttgggaggaacaatcgatgattgtgaactg
gtggaaggactggtcctgactcagaaggtggcgaacacaggtgtaactagagtggaaaaa
gccaaaattggcctcattcagttctgcctctctgctccaaagacagatatggacaaccaa
attgttgtttctgattacgctcaaatggacagagtactgcgtgaagagagagcttatatt
ctaaacttagttaagcaaattaagaaggctggatgcaatgtgctgctgattcagaagtct
attctgcgggatgctcttagtgacctcgccctacattttctgaacaaaatgaagatcatg
gtggttaaagacatagaaagagaagacatcgagtttatatgtaagaccattggaactaag
cctgttgctcatattgaccagtttactcctgacatgctgggctctgctgagctggcagag
gaggtcaacttgaacggttctgggaaactaataaagattacgggctgtacaaaccctgga
aaaacagtaaccattgtggtacgtggatccaacaaacttgttctagaagaagctgagcgt
tcaattcatgatgccctgtgtgtcattagatgcttagttaagaaaagagctttaatcgca
ggaggtggagcaccagagatagagctggcactgcgcctcaatgagtacgcccgcactttg
aggggcatggactcgtactgcgtgcgtgcctacggggatgcgctggaagtcataccatct
acgctggctgaaaacgcgggtctcaatcctatctcaacagtaacagagctgaggaacaga
cacgctcaaggggagaaaacagctggcattaatgtcagaaagggtggcatttccaacatc
ctggaggagttggtagtccagcccctgctcgtgtctgtgagtgcactgactctggcaaca
gaaactgtgcgcagtattcttaagattgatgatgtggtgaacactcggtaa

DBGET integrated database retrieval system