KEGG   Gallus gallus (chicken): 395416
Entry
395416            CDS       T01006                                 

Gene name
ABCC1
Definition
(RefSeq) multidrug resistance-associated protein 1
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1 [EC:7.6.2.3]
Organism
gga  Gallus gallus (chicken)
Pathway
gga02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    395416 (ABCC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    395416 (ABCC1)
Enzymes [BR:gga01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.3  ABC-type glutathione-S-conjugate transporter
     395416 (ABCC1)
Transporters [BR:gga02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    395416 (ABCC1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase MMR_HSR1 AAA_16 AAA_25 Zeta_toxin ABC_ATPase Dynamin_N AAA_22
Other DBs
NCBI-GeneID: 395416
NCBI-ProteinID: NP_001012540
CGNC: 49308
Ensembl: ENSGALG00000006646
UniProt: Q5F364
Position
14
AA seq 1525 aa
MGIESLCSADASEPFWDWNLTWHTENPDFTQCFQNTVLVWVPCIYLWVCFPAYFLYLRSH
DRGYIQMSILNKAKTALGLILWIVCWADLFYSFWERSQNIFRAPFFLISPTVLGITMLLA
TFLIQHERLKGVQSSGVMMIFWLISLLCATVIFRSKIMLALNTDTEVDAFRYVTFCTYFI
LLLVQLILSCFPEKPPLFSEAVNDPKPCPEFSASFLSRITFWWITGLMIQGHRRPLEAKD
LWSLNKEDTSEEIVPGLAKNWAKEWAKTKRQPLNMLYSSKKQQKSSDSNGEVMEEAEALI
IKPSQRSSEASLSKVLYKTFGPYFLMSFLFKAAHDLLMFTGPEILKLLINFVNNKSAPNW
QGYFYTGLLFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKTSTVG
EIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPSVLAGVAVMILLVPINA
VMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKK
SAYLAAMGTFTWVCAPFLVALSTFAVYVKVNKNNILDAQKAFVSLALFNILRFPLNILPM
VISSIVEASVSLKRLRVFLSHEELDPDSIIRGPITNAEGSIVVKNATFSWSKTDPPSLNS
INFTVPEGSLIAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSIAYVPQQAWIQNATLE
DNIIFGREMNESRYKRVIEACALLPDLEILPMGDRTEIGEKGVNLSGGQKQRVSLARAVY
CNADTYLFDDPLSAVDAHVGKHIFEKVIGPKGILKNKTRVLVTHAVNYLPQMDTILVMTD
GEISEMGSYQELLKQDGAFAEFLRTYANAEQSMESSDASSPSGKEGKPVENGVLVNDATG
KLMHRQLSNSSTYSRETGKSQHQSSTAELQKPLAEKNSWKLTEADTAKTGRVKATVYWEY
MKAIGLYISFLSVFLFMCNHIASLASNYWLSLWTDDPVVNGTQQYTNVRLGVYGALGISQ
GIAVFGYSMAVSIGGIFASRHLHLDLLHNVLRSPMSFFERTPSGNLVSRFSKEIDTIDST
IPPIIKMFMGSTFNVIGACIIILLATPIAAVVIPPLGLVYLLVQRFYVATSRQLKRLESV
SRSPVYSHFNETLLGVSVIRAFEEQKRFIKQNDMKVDENQKAYYPSIVANRWLAVRLEFV
GNCIVLFAALFAVIARNKLSPGLIGLSVSYSLQITAYLNWLVRMTSDLETNIVAVERVKE
YAEMEKEAEWSIEETAPASTWPQEGKVEFRGFGLRYREDLDLVLKNINITINGGEKVGIV
GRTGAGKSSLTLGLFRINEAAEGEIIIDGINIAKIGLHDLRFKITIIPQDPILFSGSLRM
NLDPFDQHSDEDIWRSLELAHLKNFVSSLPDKLNHECSEGGENLSVGQRQLVCLARALLR
KSKILVLDEATAAVDLETDNLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLDRGEVV
ECDSPDNLLQAKGLFYSMAKDSGLA
NT seq 4578 nt   +upstreamnt  +downstreamnt
atggggatcgaaagcctctgcagcgcggacgcctccgagcccttttgggattggaatctg
acatggcacacagaaaatccagacttcacccagtgctttcagaacacagtcttggtctgg
gtcccttgtatttacttgtgggtctgcttcccagcgtactttctgtatcttcgttctcat
gacaggggttacatccaaatgtcaatcctcaacaaagccaaaacggctttgggcttaata
ctgtggatagtctgctgggcagaccttttctactctttctgggaaagaagtcaaaatatt
tttcgagctccattttttctcattagccctactgtactgggtataactatgttgcttgcc
acatttttgatacaacatgaaaggttgaaaggagtacagtcttcgggcgtgatgatgatt
ttctggctcatttcattgctatgtgccacagtaatttttagatccaaaattatgcttgcc
ttaaatacagacactgaagtggatgcatttcgttacgtcactttctgcacctacttcatc
ctgttacttgtacagctcatactatcttgttttccagaaaaaccgcctttgttttctgag
gcagtaaatgatcctaaaccgtgtccagagttcagtgcttctttcctgtcaagaatcacc
ttctggtggattactgggttgatgattcagggtcatcggagacctctggaagctaaggat
ttgtggtcattaaacaaagaggacacatctgaggagatagtgccaggtttggcaaaaaat
tgggcaaaagaatgggcgaagaccaagaggcaaccgttgaacatgttatactcatccaaa
aagcagcaaaaatcaagtgactccaatggtgaagtgatggaggaagctgaagctttgatt
ataaaaccatctcagaggagttctgaggcatctttatccaaggtgttatataaaactttt
gggccgtattttctcatgagtttcctgtttaaagcagcacatgatctcttgatgtttaca
ggcccagaaattttgaaactgctaatcaacttcgtaaataacaaaagtgccccaaactgg
caaggctacttttatacagggctgctgtttgtttgtgcatgtcttcagacattgattctt
catcagtattttcatatttgttttgtaactggaatgaggctcaaaacagctattgttggt
gtaatctatcggaaggcacttgttatcacaaattctgcccgaaagacttctactgtgggt
gaaattgtgaatctaatgtctgtggatgctcagagattcatggacttggctacatatata
aacatgatctggtctgcacctctccaagtgatactagcactgtacttactgtggcggaat
ttaggtccttctgtactggcaggtgttgctgtcatgattcttctggttcccataaatgct
gtgatggcaatgaaaacaaaaacctatcaggtggcacagatgaagagcaaagacaacaga
attaagctgatgaatgaaattcttaatgggattaaagttctaaaactttatgcttgggaa
ttagcctttagagaaaaggtattggagatcagacagaaagagctcaaagtcctaaaaaaa
tctgcttaccttgctgcaatgggtaccttcacttgggtttgtgctccttttttggttgcc
ttgtccacatttgctgtgtatgtcaaagtaaacaagaacaatatcctggatgctcagaag
gcatttgtatccctagctttattcaacattctcaggtttccattgaacatacttcctatg
gttatcagcagcatagtagaagctagtgtctccttgaagcgccttcgggtgttcctgtct
catgaagagttagatccagacagcatcatcaggggtcccattacaaatgctgaaggaagc
attgttgtaaagaatgcaacgtttagctggtccaaaacggatcctccttcactgaatagc
attaacttcaccgttcccgaaggctccctgatagctgttgttggtcaggttggctgtgga
aagtcttcattgttgtctgcgttactgggggagatggacaaaaaggaaggctacgtggtt
gtcaagggctcgattgcttatgttcctcagcaagcctggatccaaaatgcgactttagaa
gacaacattatctttggaagagagatgaatgagagtcggtacaagcgtgttattgaggct
tgtgcacttttgcctgatttagagattcttcctatgggagacagaacagaaataggagaa
aagggtgtgaatttgtctggaggacagaagcagcgtgttagtcttgctcgagcagtctac
tgtaatgcagatacctatttatttgatgatcctttgtcagctgttgacgctcatgttggg
aaacatatttttgaaaaagttattggaccaaaaggaatcttgaaaaataaaacacgggtt
ttagtaacccatgcagtgaactatctgcctcaaatggatacaattctggtaatgactgat
ggagaaatctctgagatgggctcctaccaggagctgctgaagcaggatggagcttttgca
gagttccttcgtacgtacgctaatgctgaacaaagcatggagagcagtgatgcaagtagt
ccatctggaaaggaaggaaagcccgtagaaaatggagtccttgtgaatgacgccactgga
aagctgatgcatcggcagctcagtaactcctccacatacagcagagaaactgggaagtca
cagcaccagagcagcacagcagagctgcagaagcctcttgcagagaagaattcctggaaa
ctgacagaggctgacacagcaaagactgggagggtaaaggcaacagtatactgggaatac
atgaaagctattggactctatatctcttttctgagcgttttcctctttatgtgtaaccat
atagcctccctggcttccaactactggctaagtttatggacagatgatccggttgtcaat
gggacacagcagtacacaaatgtcagactgggagtatatggagcgctgggaatttctcaa
ggtattgctgtgtttggctactcgatggctgtgtcaataggaggaatatttgcttcacgg
cacctgcacctcgacctgctgcacaatgttctcaggtctccaatgagtttctttgaacgt
acacccagtggaaatttagtgagccgtttctctaaggagatagataccattgactctacc
attccaccaatcatcaagatgttcatgggctcaacatttaacgtgattggggcttgtatc
atcattttgctggccacccctatagctgctgtcgttattccacctctgggacttgtctac
ttgcttgtgcagagattttatgtggccacttctcgccagctcaaacgccttgaatctgtt
agtcgttctcctgtgtattctcacttcaatgagacccttctgggagtcagtgtaattcga
gcctttgaggaacagaaacgttttataaagcagaatgacatgaaagtggatgaaaatcag
aaagcttattacccaagcattgttgcaaacagatggctggcagtacgtctggagtttgtg
gggaactgtattgttctctttgcagcattgtttgcagtgattgcacgcaacaagctcagt
ccgggactgattggtctttcagtgtcctattcgctgcagattacagcatacttaaactgg
ctagttcgtatgacatctgatctggaaaccaacattgttgctgtagaaagagtcaaagaa
tatgctgaaatggagaaggaggctgagtggagtattgaagaaactgccccagcaagcacc
tggcctcaggaggggaaggttgagtttcgaggctttggtttacgttaccgggaagacttg
gatttggttctgaaaaatataaacatcaccataaatgggggtgagaaggtaggaatagtt
ggaagaacaggagctggaaaatcctcccttactttaggcttatttcggatcaatgaagca
gctgaaggagaaattattattgatggaattaatattgcaaagatagggctccatgacttg
cggttcaagataaccataattcctcaggaccccatattattttctggttctctgcgtatg
aatctcgatccttttgaccaacactccgatgaagacatttggagatctttggaattggct
cacttgaaaaattttgtgtcatcccttcctgataaactcaatcatgagtgttctgaaggt
ggagaaaacctcagtgtgggacagcgccagctggtgtgcctggcacgagctctgctcagg
aagtccaaaatcctggttctagatgaagccacagctgctgttgatctggagacagataac
ctcatacagtcaacaataaaatctcaatttgaagaatgtactgttttaactatagcacat
cgtctgaacacaatcatggactatacaagagttttagtcctggacagaggtgaagtggtg
gagtgtgatagcccagacaacctacttcaggcaaaaggccttttctatagcatggccaaa
gactcaggattggcgtag

DBGET integrated database retrieval system