KEGG   Gallus gallus (chicken): 395432Help
Entry
395432            CDS       T01006                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10 precursor
  KO
K04358  fibroblast growth factor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395432 (FGF10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    395432 (FGF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    395432 (FGF10)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395432 (FGF10)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   395432 (FGF10)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   395432 (FGF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin SR-25 TraW_N
Motif
Other DBs
NCBI-GeneID: 395432
NCBI-ProteinID: NP_990027
CGNC: 49317
Ensembl: ENSGALG00000014872
UniProt: O42407
Position
Z
AA seq 212 aa AA seqDB search
MCKWILTNGASAFSHLPCCCLLLLFLVSSVPVTCHDLGQDMLSPEATNSSSSSSSSFPSS
FSSPSSAGRHVRSYNHLQGDVRKRKLYSYNKYFLKIEKNGKVSGTKKENCPFSILEITSV
EIGVVAVKSIKSNYYLAMNKKGKVYGSKEFNSDCKLKERIEENGYNTYASLNWKHNGRQM
FVALNGRGATKRGQKTRRKNTSAHFLPMVVMS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaatggatactgacaaatggtgcctcagccttttcccacctgccttgttgctgc
ttgctgctgctcttcttggtgtcttctgtgcctgtcacctgccatgacctcggccaggac
atgctgtccccggaggccaccaactcttcttcttcatcatcctcctccttcccctcgtcc
ttctcctctccttccagtgcggggagacacgtgcggagctacaatcacctccaaggagac
gtgcgcaagaggaagctctactcttacaacaaatactttctcaagatcgagaagaacggc
aaggtcagcggcaccaagaaggagaactgccccttcagcatattggagataacatctgta
gaaattggagttgtggcagttaagtccatcaaaagcaactattatttagctatgaacaag
aaaggaaaagtctacggctctaaggagtttaatagtgattgcaaattgaaggaaagaata
gaagaaaatggatacaatacatatgcatccttaaattggaagcacaatggaaggcaaatg
tttgttgctctgaatggaaggggagccacaaagaggggacaaaaaacaagaaggaaaaac
acttcagctcactttcttccaatggtagtaatgtcatag

DBGET integrated database retrieval system