KEGG   Gallus gallus (chicken): 395443Help
Entry
395443            CDS       T01006                                 

Gene name
SLC1A3
Definition
(RefSeq) excitatory amino acid transporter 1 isoform X2
  KO
K05614  solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    395443 (SLC1A3)
   04147 Exosome [BR:gga04147]
    395443 (SLC1A3)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   395443 (SLC1A3)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   395443 (SLC1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-GeneID: 395443
NCBI-ProteinID: XP_025000702
CGNC: 2616
Ensembl: ENSGALG00000003582
Position
Z
AA seq 382 aa AA seqDB search
MLPGRGTSERSMKRNMFPPNLVEACFKQFKTNYEKRMFKVDIPSNDTSTVASIISNVSAA
VETLTQMREEMVPVPGSVNGVNALGLVVFSISFGLVIGSMKEQGQALKDFFDSLNEAIMR
LVALIMWYAPLGILFLIAGKIVEMEDMGVIGGQLAMYTVTVIIGLLIHAVIVLPLLYFLI
TRKNPWVFIGGLIQALVTALGTSSSSATLPVTFKCLEEINGVDKRVTRFVLPVGATINMD
GTALYEALAAIFIAQVNNFDLNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGL
PTDDITLIIAVDWFLDRLRTTTNVLGDSIGAGIVEHLSRHELKNRDAEMGNSVIEENEMK
KPYQLISQENESEKPLDSETKM
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaggaagggggacttcagaaagatccatgaagagaaatatgttccctccaaat
ctggtggaagcttgctttaaacagttcaaaactaactatgaaaagagaatgttcaaagta
gatatcccgtccaatgacacatccacagtggcttccataataagtaatgtatcagcagca
gtggaaaccctcacgcaaatgagagaggaaatggttcctgttccaggttctgtaaatgga
gtgaatgcccttggcttggtggttttttcaataagctttggcctggtgattggaagcatg
aaggagcaaggtcaggccttaaaagacttctttgatagccttaatgaggctatcatgaga
ctggtagctctaatcatgtggtatgctccacttggaatcctctttctgattgctggaaaa
attgttgagatggaagatatgggtgtgattggtggtcagcttgccatgtatactgtaaca
gttataatcggtttgcttattcacgctgtcatagtcctacctctgctgtacttcctaatc
actcgtaagaacccttgggtatttattggaggcctaatccaggctctggtcacagctttg
ggaacatcttccagttctgcaacactgcctgttacatttaagtgtctagaagaaataaat
ggagtggacaaacgagttacaagatttgtactgccagttggtgctaccattaatatggat
ggaactgcattatatgaggctttggctgcaattttcattgcacaggttaacaactttgat
ctgaactttgggcagattatcacaatcagcatcacagctacagctgccagtattggggct
gcgggcattcctcaagctgggctggtcaccatggtcattgtgcttacatcagtaggtttg
cctacggatgatatcactcttatcattgcagtggactggttcttggatcgtctccgtacc
actaccaatgtcttgggagactccattggagcagggattgttgaacacttatcacggcat
gagctgaagaacagggatgccgagatggggaattctgtgatagaggagaatgaaatgaag
aaaccgtaccagctgatctcacaagaaaatgagagtgagaaaccattagacagtgaaacc
aagatgtag

DBGET integrated database retrieval system