KEGG   Gallus gallus (chicken): 395445
Entry
395445            CDS       T01006                                 

Gene name
BOK
Definition
(RefSeq) bcl-2-related ovarian killer protein
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 395445
NCBI-ProteinID: NP_990037
CGNC: 4304
Ensembl: ENSGALG00000005772
UniProt: Q9I8I2
Structure
PDB: 
5WDD

Position
9
AA seq 213 aa
MEVLRRSSVFAAEVMEVFDRSPTDKELVSQAKALCRDYINSRLIRAGVSWSKPEHNTPVP
GGKLAEVSAILLRLGDELEYIRPNVYRNIARQLNISLHSETVVTDAFLAVAAQIFTAGIT
WGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRKTLVTWLKRRGGWADITKCVV
STDPSLRSHWLVAAVCSFGHFLKAIFFVLLPER
NT seq 642 nt   +upstreamnt  +downstreamnt
atggaagtgctgcgccgctcgtccgtctttgctgcagaggtgatggaggtgttcgacagg
tctcccactgacaaggagcttgtgtcccaagccaaggctctctgcagggactacatcaac
tccaggctgatccgtgcaggcgtcagctggagcaaacctgagcacaataccccggtgcct
ggaggcaagctggctgaggtgtctgccatcctgctgcgcctgggggatgagctggaatac
attcgccccaacgtctaccgcaacatcgcccgccagctgaacatctcgctgcactcggag
acggtggtgacggatgctttcctggccgtggctgcgcagatcttcactgcaggcataaca
tggggcaaggtggtgtctctctatgccgtggcagcggggctggcagtggactgcgtgcgg
cacgcacagccagccatggtccacaccatcgtggactgcctgggagagtttgtccgcaag
accttggtgacgtggctgaagaggcgaggaggctgggcagacatcaccaagtgcgtggtg
agcaccgaccccagtctccgttcccactggctcgtggccgccgtctgcagctttgggcac
ttcctcaaggccatcttctttgtgctgctgcccgagagatga

DBGET integrated database retrieval system