KEGG   Gallus gallus (chicken): 395449Help
Entry
395449            CDS       T01006                                 

Gene name
RAD54B
Definition
(RefSeq) DNA repair and recombination protein RAD54B
  KO
K10877  DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    395449 (RAD54B)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     395449 (RAD54B)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     395449 (RAD54B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII HDA2-3
Motif
Other DBs
NCBI-GeneID: 395449
NCBI-ProteinID: NP_990041
CGNC: 49325
Ensembl: ENSGALG00000043597
UniProt: Q9DG67
Position
2
AA seq 918 aa AA seqDB search
MRRSAAPSQVLGNVAKKPRFIPPGKSNALCPKIETEETDQDVKLKEIGEKHGNASLFSEM
FSENQSENFTQSVESSGKVKSTKAWNSTSKCSKLEMKTQSAPKADAMHLPTSGMAKEAAA
QEEPDCLTKYFSVMWCKASKKKHKKWEGDAILITKGKSVILKDMEGKDIGRGTGYKSKEL
DSLEEGQTLMIGGKEIEVMGVISADDFSSGRCFQAGIATHDTVPTALPQTTMKQFCKPIK
SACQPSTKENILLNPQSCKPRHNPNDTNSLVMPRPNASHQCMFNKAGLPVVDVVVDPYIA
NNLRPHQREGIVFLYECVMGMRVSGRFGAILADEMGLGKTLQCISLVWTLLRQGVYGCKP
VLKRALIVTPGSLVKNWKKEFQKWLGSERIKVFTVDQDHKVEEFISSPLYSVMIISYEML
LRSLDQIQAIEFNLLICDEGHRLKNSSIKTTTALTNLSCERRIILTGTPIQNDLQEFYAL
IEFVNPGVLGSLSTYRKIYEEPIVRSREPSATKEEKDLGEKRAAELTRLTGLFILRRTQE
VINKFLPPKKENIIFCQPTALQLELYRKLLSSRVISSCLQGRLENSPHLICIGALKKLCN
HPCLLFKALKEKCCDPKSDEHVESSLYEGLTDVFPQDYTSDTFSEIDSGKLQVLVKLLAA
IRELSSSERVVLVSNYTQTLNVLLETCKCYGYSYTRLDGNTPVSQRQQIVDSFNSKFSPA
FIFLLSSKAGGVGLNLVGASHLILYDIDWNPATDIQAMARVWRDGQKCTVHIYRLLTTGT
IEEKIYQRQISKQDLSGAVVDLSKTSEHIHFSVEELRNLFTLHENSSCVTHDLLECDCMG
NKDHQNPSSKKPSVSRCCQLRQDQGKHNSKKPLSMSQLMQWKHFSGQHQALPDPFLERIK
ENVSFIFQNVTNATSPTQ
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgatcggcagctccaagtcaagtgctaggaaatgtagccaaaaagccaaggttt
ataccaccaggaaaaagtaatgcactttgtcccaagattgaaaccgaggaaacggaccaa
gacgtgaaattaaaggagataggtgaaaaacatggaaacgcttcactgttttctgaaatg
ttcagtgagaatcagagtgaaaattttacacagtctgttgagtcatctggaaaagtaaag
tctacaaaagcatggaacagcactagtaagtgcagcaagttggaaatgaaaacacagagt
gcacccaaagcagatgcaatgcatttgccaacatcagggatggcaaaggaagcagcagcg
caggaagaacctgactgcctcacgaagtatttcagtgttatgtggtgtaaggcatcaaag
aagaagcacaagaagtgggaaggcgatgctattcttattacaaaaggaaagtcagtaata
ttgaaagacatggaaggcaaagacattggcagaggtactggatataaatctaaagagtta
gacagtcttgaggaaggtcaaacactgatgattggaggaaaagaaattgaagtgatgggt
gtaatttcagcagatgacttcagcagtggcaggtgttttcaggctggaatagcgactcat
gacacagtcccaactgctttacctcaaactaccatgaaacaattctgtaagccaatcaaa
agtgcctgccaacccagtactaaagagaatattctcctcaatcctcagagctgcaaacct
cgtcacaatccaaatgatacaaattccctagttatgccaagaccaaatgcaagtcatcag
tgcatgttcaacaaggctggtttacctgtggtggatgtcgtcgtggatccttacattgca
aataatctccgaccacatcagagagaaggaattgtatttctatatgaatgtgtaatggga
atgagagttagtggcagatttggagctattcttgctgatgaaatgggcttaggaaaaaca
ttgcagtgcatttcacttgtctggacccttctgcgtcaaggggtctatggatgtaaacct
gtactaaagcgagcactaattgtcacccctgggagtctggtaaaaaactggaaaaaagaa
tttcagaaatggctgggaagcgaaaggatcaaagtctttacagttgatcaggaccacaaa
gtagaagaattcatcagttctccactttattcagttatgataatcagctatgagatgcta
ctacgatctctggatcaaattcaggctatagaatttaacctcctgatctgtgatgaagga
catcgtctgaaaaatagctctattaagacaactacagccctcactaatctgtcttgtgag
aggaggattatccttactggtactccaatccaaaatgacttacaagaattttatgcatta
atagaatttgtaaatccaggagtacttggttctttatccacatacagaaagatatatgag
gagcccatcgtcagatctagagaaccttcagcaacaaaggaggaaaaggatttaggagaa
aaaagagcagcggaactcacacgcctcactggactctttattcttaggagaacacaggag
gttataaacaaatttcttccaccaaaaaaggagaacataatcttctgccaaccaacagca
ctgcagcttgaattgtatcggaaactgctcagttctcgagttattagctcctgtctacaa
ggcaggctagaaaatagtcctcacctaatatgcataggagctttgaaaaaactttgcaat
catccatgtcttctgttcaaagctttaaaggaaaaatgctgtgatccgaaaagtgatgag
catgttgagtccagtctctatgaaggtctaacagatgtctttccacaagattatacttct
gacactttctccgaaattgattcaggaaaattgcaggtgctggtgaagttgttagcagca
atccgagagctcagctcttctgaaagagttgtactggtatccaattacactcagacactg
aacgtactactggagacatgcaaatgttacggatattcttatactagacttgatggaaat
actcccgtctcccagaggcaacagattgttgatagttttaatagtaaattcagcccagct
ttcatctttttgctgagttcaaaagctggtggagtgggactgaatctggttggagcttct
cacttgatcctatatgatatcgactggaatccagctactgatattcaggcaatggccaga
gtgtggagagatggtcagaaatgtactgtacatatctacagacttctaaccacaggcaca
atagaagaaaagatttatcaaagacaaatcagcaaacaggacctttcgggggcagttgta
gacctttccaagacatctgaacatatccatttttctgttgaggagctcagaaatctcttt
acacttcatgagaattccagctgtgttacccatgacttacttgaatgtgattgtatggga
aacaaagaccatcaaaatccttcttcaaaaaaaccttcagtgtctagatgttgtcagctc
agacaagatcaggggaaacataattcaaagaaacctctctccatgtcacagttgatgcaa
tggaagcatttctctgggcaacatcaggctctacctgatccttttcttgaaaggataaaa
gaaaatgtttctttcattttccagaatgtaaccaatgcaacttcccccacccaataa

DBGET integrated database retrieval system