KEGG   Gallus gallus (chicken): 395450
Entry
395450            CDS       T01006                                 

Gene name
NTM
Definition
(RefSeq) protein CEPU-1 precursor
  KO
K06774  neurotrimin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    395450 (NTM)
Cell adhesion molecules [BR:gga04515]
 Immunoglobulin superfamily
  IgLON family
   395450 (NTM)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Ig_5 Izumo-Ig C2-set_2 Ig_4 Ig_C17orf99
Other DBs
NCBI-GeneID: 395450
NCBI-ProteinID: NP_990042
CGNC: 49326
Ensembl: ENSGALG00000001437
UniProt: Q90773
Position
24
AA seq 353 aa
MAQAKMQHPVSWVIFAGMAALLLFQGVPVRSGDATFPKAMDNVTVRQGESATLRCSVDNR
VTRVAWLNRSSILYAGNDKWCLDPRVVLLANTKTQYSIQIHDVDVYDEGPYTCSVQTDNH
PKTSRVHLIVQVSPKITETSSDISINEGGNVSLTCIATGRPDPTITWRHISPKAVGFISE
DEYLEITGITREQSGEYECSASNDVAAPVVQRVKVTVNYPPYISDAKSTGVPVGQKGILM
CEASAVPSADFQWYKDDKRLAEGQKGLKVENKAFFSRLTFFNVSEQDYGNYTCVASNQLG
NTNASMILYEETTTALTPWKGPGAVHDGNSGAWRRGSCAWLLALPLAQLARQF
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcccaggcgaaaatgcagcaccccgtctcatgggtgatcttcgccgggatggccgca
ctcctcctcttccaaggagtgcccgtgcgcagcggagatgccaccttccccaaagctatg
gacaacgtgactgtgcggcaaggggagagtgccacgctcaggtgctccgtggacaaccgc
gtcacccgcgtggcctggctgaaccgcagcagcatcctctatgccggcaatgacaagtgg
tgcttggacccgagggtggtgctcctggccaacaccaaaacccagtacagcatccagatc
cacgacgtggacgtgtacgatgaagggccctacacctgctccgtgcagacagacaatcac
cccaagacatctcgcgtgcacctcattgtgcaagtgtcgccgaaaattaccgagacctct
tctgacatctccatcaatgaaggtggcaacgtcagcctcacctgcatagccacgggcagg
ccagaccccacaatcacctggagacacatctcgcccaaagctgtgggcttcatcagcgag
gacgagtacctggagatcacaggcatcacgagggagcagtcgggcgagtacgagtgcagt
gcctccaacgacgtggccgcgcctgtcgtccagcgagtcaaagtcaccgtcaactaccca
ccgtacatttcggatgcgaagagcaccggtgtgccggtggggcagaagggcatcctgatg
tgtgaagcctccgctgtgccctccgctgacttccagtggtacaaagacgacaagcggctg
gctgaaggacagaaagggctgaaggtggaaaacaaagccttcttctcccgactgactttc
ttcaacgtctccgagcaggactacggcaactacacctgcgtggcctccaaccagctagga
aacaccaacgccagcatgatcctttatgaagagacaacaaccgctctgacaccctggaaa
ggccccggtgcagtgcacgatggcaacagcggtgcgtggcggcgaggcagctgtgcctgg
ctgctggccctgccgctcgcccagctcgcccgccagttctga

DBGET integrated database retrieval system