KEGG   Gallus gallus (chicken): 395452
Entry
395452            CDS       T01006                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase precursor
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    395452 (RDH5)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     395452 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 395452
NCBI-ProteinID: NP_990044
CGNC: 49327
UniProt: Q9DGM0
Position
33
AA seq 319 aa
MWLYLLLVVLAWALGWLVRDRQTLPSVKDKHVFITGCDSGFGNLLARRLAQRGFRVLATC
LTPQGADGLQRGCAGHLRTTLLDVTRSDSIRRAAEWVREEVGEKGLFGLVNNAGVANPIG
PTEWMRIEDYRQVMAVNTFGAIEVTLQLLPLLKRARGRVVNTSSVLGRLSANGGGYCVSK
YCIEAFSDSLRRDMYHFGVKVSIVEPGFFKTAVTNLESIEASLRQLWERLAPETRLSYGE
EFFHKYLRVQRFIMNIICDADLGKVTRCMEHALGACHPRTRYSAGWDAKLLWLPASYLPA
CIVDFVLATILPKPAHHVR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggttgtacctgttgttggtggtgctggcctgggccctgggctggctggtacgggat
cgccaaaccctgccctcagtcaaagacaaacacgtcttcatcaccggctgcgacagcggc
tttggcaacctgctggcacggcggcttgcccagcgtggcttccgtgtgctggctacttgc
ctgaccccacaaggggccgatgggctgcagcgaggctgcgccgggcacctccggaccacg
ctgctggatgtcacccgctctgatagcatccggcgtgctgcggagtgggtgagggaggag
gtgggcgagaaagggctctttgggctggtgaacaacgctggggtggccaaccccatcggc
cccacggagtggatgcggatcgaggactaccggcaggtgatggccgtcaacacttttggg
gccatcgaggtgaccctacagctgctgcccctcctcaagagggcgcggggccgcgtggtc
aacacctccagcgtgctcggccgcctctcggccaatggtggcggctactgcgtctccaag
tattgcatcgaggcgttctccgacagcctcaggcgcgacatgtaccacttcggggtgaag
gtgagcatcgtggagcccgggttcttcaagacagccgtgaccaacctggagagcatcgaa
gcgtcgctgcggcagctctgggagcgtctggcacccgagacacggctcagctacggcgag
gagttcttccacaagtacctgagggtgcagaggttcatcatgaacatcatctgtgatgct
gacctgggcaaggtgacgcgctgcatggagcacgctctgggcgcctgccacccacgcaca
cgctacagtgcaggctgggatgccaagctgctgtggctgcccgcctcctacctgcccgcc
tgcatcgttgactttgtgctggccaccatcctgcccaagccagcccaccacgtccgctag

DBGET integrated database retrieval system