KEGG   Gallus gallus (chicken): 395454
Entry
395454            CDS       T01006                                 

Gene name
PCSK6
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 6 isoform X1
  KO
K08672  proprotein convertase subtilisin/kexin type 6 [EC:3.4.21.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    395454 (PCSK6)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    395454 (PCSK6)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     395454 (PCSK6)
Peptidases and inhibitors [BR:gga01002]
 Serine peptidases
  Family S8: subtilisin family
   395454 (PCSK6)
Chaperones and folding catalysts [BR:gga03110]
 Intramolecular chaperones
  Subtilisin family
   395454 (PCSK6)
SSDB
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain GF_recep_IV Furin-like_2 PLAC
Other DBs
NCBI-GeneID: 395454
NCBI-ProteinID: XP_025009761
CGNC: 49329
Ensembl: ENSGALG00000030076
Position
10
AA seq 926 aa
MRAPPASAPAPRRGAPPPPAPLCLLVLTLLLWGRGGAAGPSRTVYTNHWAVRVRGGPAEA
ARLAAAYGYISLGQIGSLENYYHFHHSKTFKRSTLSSRGPHSFLRMDPKVEWLQQQEVRR
RVKRHVRSDPPSLPFNDPVWPNMWYLHCGDRNSRCRSEMNVVAAWQRGYTGRNVVVTILD
DGIERNHPDLLQNYDPLASYDVNGNDHDPTPRYDASNENKHGTRCAGEVAAAANNSYCIV
GIAYNARIGGIRMLDGDVTDVVEAKSLGIRPDYIDIYSASWGPDDDGKTVDGPGLLAKQA
FEHGIKKGRRGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTTENGYKPWYLEEC
ASTLATTYSSGAFYERKIVTTDLRHRCTDGHTGTSVSAPMVAGIIALALEANPLLTWRDV
QHLLVRTSRPVHLRAADWKTNGAGHKVSHLYGFGLVDAEAIVVEAKKWKTVPPQHVCVGS
LDRVPKYIRPDHVLRASTLSSACSEQREQHVLYLEHVVVRLSIAHPRRGDLQISLVSPAG
TRSQLLARRVFDHSNEGFKGWEFMTVHCWGERAAGEWTLEIQDTPSQVRSPTAQGKLKEW
SILFYGTAEHPYNTPGAPQPRTRTLEVSEMEPSRAAFLQSQVEMTEEEEEEYAGPCHPEC
GDQGCDGPSADQCLNCIHYSLGSVKTGRMCVSSCPAGFFGDKAARRCRRCYKGCESCVGR
GPGQCTACKRSLYHHPEMGACLPLCPPSFYAEERQKRCLKCHQSCKKCLGEPDKCTACKD
GFSLVGESCVPECQPAMYLSREHRRCETCPAGTGPGEDDCTPCTPDTSAPHWRCVPACRE
GFYPADSHGLPNKVCKRCDEHCSACEGSSGNCVRCKDGFSLLGGSCVTNETCTNADKTFC
EMVKSNKLCEKKLFVQFCCQTCLMAG
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgcgcgcacctccggcctccgcgcccgccccgcgccgcggagcccccccgccgcccgcc
cccctctgcctcctggtcctgaccctgctcctttggggtcgggggggggcggcagggccc
tcccgcaccgtctataccaaccactgggccgtccgcgtgcgggggggcccggccgaggcc
gcccgcctggcagccgcctatgggtacatcagcttagggcagattggcagcttggaaaac
tactaccacttccaccacagcaaaacgttcaagcgctcaacgctgagcagccggggaccg
cacagcttcctccgcatggaccctaaggtggagtggctgcagcagcaggaggtgcggcgg
cgggtgaagaggcacgtccgcagcgatcccccctcactgcccttcaacgacccggtgtgg
cccaacatgtggtacctgcactgcggggacaggaacagccgctgccgctcggagatgaat
gtggtcgctgcctggcagaggggctacaccggcaggaacgtggtggtcaccatccttgat
gacgggatagagaggaaccaccccgacctgctgcagaactacgaccctctcgcaagctac
gatgtcaatgggaatgaccatgacccaacgccacgctatgatgccagcaatgagaataag
cacggcacacgctgcgcgggggaggtggcagcagcagccaacaactcgtactgcattgtg
ggcattgcctacaacgcacgcattggaggcattcgtatgttagatggagatgtaacagat
gttgttgaagcgaagtcgcttggcatcagacccgattacattgacatttacagcgcgagc
tgggggccagatgatgatgggaagacagttgatggacccggcctattggccaagcaggct
tttgagcatggcattaaaaagggtcgcaggggcttggggtccatttttgtctgggcatca
ggaaatggcggccgggagggcgactactgctcctgtgatggctacaccaacagcatctac
accatctccatcagcagcaccaccgagaacggctacaagccctggtacctggaggagtgt
gcatccaccctggccaccacctacagcagcggggccttctatgagcggaaaattgtcacc
accgacctccggcaccgctgcactgatggccacaccggcacctccgtgtctgcacccatg
gtggctggcatcattgccttggctttggaggcaaaccccctgctcacgtggagggatgtc
cagcacctcctggtcaggacctcacggccagtacacctgcgggcagccgactggaagacc
aatggagcagggcataaagttagccatctatatggcttcggcctggttgatgcagaagct
atagtagtggaagccaagaaatggaagacagtgccaccccaacacgtctgcgtgggaagc
ctggacagggtacccaagtacatccgcccggaccacgtgctgcgcgccagcactctgagc
agtgcctgcagcgagcagcgcgagcagcacgtgctgtacctggagcacgtggtggtgcgg
ctcagcatcgcgcacccgcgccgcggtgacctgcagatcagcctcgtgtctccagcaggg
accaggtcacagctcctggccaggagagtgtttgaccattccaatgagggtttcaagggc
tgggagttcatgacggtgcactgctggggcgagagggcagctggcgagtggacactggag
atccaggacacaccatcccaggtgcgcagccccactgcgcaagggaagctgaaggagtgg
agcatcctcttctacgggacggctgagcacccctacaacactccaggggccccccagccc
cgtacaaggacactggaggtatcggagatggaaccatcgagggctgccttcctgcagagc
caggtagagatgacggaggaggaggaggaggagtatgcaggtccctgccaccccgagtgt
ggtgaccagggctgcgatggccccagcgccgatcagtgcctgaactgcatccactatagt
ctgggcagcgtgaaaactggcaggatgtgtgtcagctcctgcccagcagggttctttggc
gacaaggcagcgcggaggtgccggcggtgctacaagggctgtgagagctgtgttggccgg
ggcccagggcagtgcacagcgtgcaagaggagcctctaccaccaccctgagatgggtgcc
tgcctgcccctgtgcccccccagcttttacgccgaggaacgtcagaaacgctgtctgaaa
tgccatcaaagctgtaaaaagtgtctcggcgagccggataagtgtactgcatgcaaagat
gggttcagcctggtgggagagagctgcgtgcctgagtgccaacctgccatgtacctcagc
cgtgagcaccggcgctgcgagacctgccctgctggcacaggaccgggtgaggacgactgc
acgccctgtacccctgacacctctgcacctcactggcgctgcgttcctgcctgccgggag
ggcttctatcccgccgacagccacgggctgcccaacaaggtctgcaagaggtgcgacgag
cactgctccgcctgcgagggctccagtgggaactgtgtgcggtgtaaggatggcttcagc
cttctcggtggctcctgcgtgaccaacgagacctgcaccaatgctgacaagactttctgt
gagatggtgaaatcaaacaagctctgtgaaaagaagctgtttgtgcagttctgctgtcag
acgtgtcttatggccgggtaa

DBGET integrated database retrieval system