KEGG   Gallus gallus (chicken): 395476
Entry
395476            CDS       T01006                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04115  p53 signaling pathway
gga04210  Apoptosis
gga05132  Salmonella infection
gga05164  Influenza A
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395476 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    395476 (CASP3)
   04115 p53 signaling pathway
    395476 (CASP3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    395476 (CASP3)
   05168 Herpes simplex virus 1 infection
    395476 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    395476 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    395476 (CASP3)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     395476 (CASP3)
Peptidases and inhibitors [BR:gga01002]
 Cysteine peptidases
  Family C14: caspase family
   395476 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 395476
NCBI-ProteinID: NP_990056
CGNC: 8080
Ensembl: ENSGALG00000010638
UniProt: O93417
Position
4
AA seq 283 aa
MMTDIKDGPRSGEDVSDARSFPGSKGMNLPASKSVDSGILPDDSYRMDYPEIGVCVIINN
KNFHRDTGLSSRSGTDADAASVREVFMKLGYKVKLNNDLSSRDIFKLLKNVSEEDHSKRS
SFVCVLLSHGDEGLFYGTDGPLELKVLTSLFRGDKCRSLAGKPKLFFIQACRGTELDSGI
EADSGPDETVCQKIPVEADFLYAYSTAPGYYSWRNAAEGSWFIQSLCRMLKEHARKLELM
QILTRVNRRVAEYESCSTRQDFNAKKQIPCIVSMLTKEFYFPC
NT seq 852 nt   +upstreamnt  +downstreamnt
atgatgacagacataaaagatggaccacgctcaggggaagatgtatcagatgcaagatct
ttccctggttccaaaggaatgaacttacctgctagcaagtctgtggactctggaattctg
cctgatgacagttacagaatggattatccagagataggagtatgtgttataataaacaat
aagaacttccaccgagataccggactgtcatctcgttcaggcacggatgcagatgctgca
agtgtcagagaagtttttatgaagctgggatataaagtcaagcttaacaatgatctgtca
agcagagatatttttaagctattgaaaaatgtttctgaagaagatcacagcaagcgaagc
agttttgtttgtgtgttgctaagccatggcgatgaaggactcttctatggtacagatggc
cctcttgaactgaaagtactaaccagccttttcagaggtgacaagtgcagaagtctagca
gggaaacccaaactctttttcattcaggcctgtagaggaacagaattagattctggtatt
gaagcagacagtggaccagatgaaacagtgtgtcaaaaaatacctgtagaagcagacttc
ctgtatgcatattctactgctccaggctactactcctggaggaacgcagctgaaggctcc
tggtttattcagtctctgtgtaggatgctgaaggaacacgccaggaaacttgaactcatg
cagattttaactcgtgtaaatcgcagagtggcagaatatgaatcctgctccactcgacag
gatttcaatgcaaagaaacagattccatgcattgtgtctatgcttaccaaagaattctac
tttccttgctaa

DBGET integrated database retrieval system