KEGG   Gallus gallus (chicken): 395486
Entry
395486            CDS       T01006                                 

Gene name
POLR2F
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC2
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
gga  Gallus gallus (chicken)
Pathway
gga03020  RNA polymerase
gga04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    395486 (POLR2F)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    395486 (POLR2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    395486 (POLR2F)
   03400 DNA repair and recombination proteins [BR:gga03400]
    395486 (POLR2F)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     395486 (POLR2F)
  RNA polymerase III system
   RNA polymerase III
     395486 (POLR2F)
  RNA polymerase I system
   RNA polymerase I
     395486 (POLR2F)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      395486 (POLR2F)
SSDB
Motif
Pfam: RNA_pol_Rpb6 DUF5102
Other DBs
NCBI-GeneID: 395486
NCBI-ProteinID: NP_990065
CGNC: 9336
Ensembl: ENSGALG00000012291
UniProt: Q9PT88
Position
1
AA seq 127 aa
MSDNEDNFDGDDFDDVEEDEGLDDLENVEEEGQENVEILPSGERQAANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtcggacaacgaggacaactttgatggggatgacttcgacgatgtggaggaagacgag
gggctggatgatctggagaacgtggaggaggagggacaggagaatgtggagatcctcccc
tctggagagcgacaggcagcgaaccagaaacgtatcaccaccccctacatgaccaagtat
gaacgagccagagttctgggcacgcgtgccctccagatagcgatgtgtgcacctgtgatg
gtggagctggaaggagagacagaccccttgctgattgccatgaaagaactcaaagcacgc
aagattcctatcatcatccgtcgttacctgcctgatgggagttatgaggactggggtgtg
gatgagctaattatcacagactga

DBGET integrated database retrieval system