KEGG   Gallus gallus (chicken): 395491Help
Entry
395491            CDS       T01006                                 

Gene name
TWIST1
Definition
(RefSeq) twist-related protein 1
  KO
K09069  twist
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395491 (TWIST1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    395491 (TWIST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH HTH_51 DUF773 GDH_N
Motif
Other DBs
NCBI-GeneID: 395491
NCBI-ProteinID: NP_990070
CGNC: 49342
Ensembl: ENSGALG00000041640
UniProt: Q9PVG4
Position
2
AA seq 190 aa AA seqDB search
MMQQDESNSPVSPADDSLSNSEEEPDRQQLPSAKRGGRKRRSSRRSAGGAVGAADEPCSP
AQGKRGKKCGAGAGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALR
KIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRM
EGAWSMSASH
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcaggacgagtcaaactctccagtctcccccgccgacgacagcttgagcaac
agcgaagaggagccggaccggcagcagctgcccagcgccaagagggggggccgcaagcgc
cgctccagccggcgcagcgccgggggcgccgtcggggccgcggacgagccctgcagcccg
gctcaaggcaagcggggcaagaagtgcggggcgggcgcgggaggcggcggcggcggcggc
agcagcagcggcggcggcagcccgcagtcctacgaggagctgcagacccagcgggtcatg
gccaacgtgcgggagcggcagcgcacgcagtccctgaacgaagctttcgccgcgctgcgg
aagatcatccccacgctgccctcggacaagctgagcaagatccagaccctcaagctggcg
gccaggtacatcgacttcctctaccaggtcttacagagcgacgagctggactccaagatg
gcaagctgcagctatgtggcccacgagcggctcagctacgccttctcggtgtggagaatg
gagggcgcctggtccatgtccgcatcccactag

DBGET integrated database retrieval system