KEGG   Gallus gallus (chicken): 395497Help
Entry
395497            CDS       T01006                                 

Gene name
ATP6V1B2
Definition
(RefSeq) V-type proton ATPase subunit B
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
gga  Gallus gallus (chicken)
Pathway
gga00190  Oxidative phosphorylation
gga01100  Metabolic pathways
gga04145  Phagosome
gga04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    395497 (ATP6V1B2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    395497 (ATP6V1B2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    395497 (ATP6V1B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395497 (ATP6V1B2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   395497 (ATP6V1B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N DUF2481
Motif
Other DBs
NCBI-GeneID: 395497
NCBI-ProteinID: NP_001280170
CGNC: 49347
Ensembl: ENSGALG00000033663
UniProt: Q9I8A2 A0A1D5PP57
Position
22
AA seq 503 aa AA seqDB search
MAAVAAARRMVNGAGPGGAREQAAALTRDFLSQPRLTYKTVSGVNGPLVILDQVKFPRYA
EIVHLTLPDGTRRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLG
RVFNGSGKPIDRGPAVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKI
PIFSAAGLPHNEIAAQICRQAGLVKKSKDVMDYSEENFAIVFAAMGVNMETARFFKSDFE
ENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALRE
VSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLT
GYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIG
KDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFIAQGPYENRTVYETLDIGWQLLRIFPK
EMLKRIPQTTLAEFYPRDSTAKH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggcggcggcgcgccgtatggtgaacggcgccgggcccggcggggcgcgc
gagcaggcggcggcgctgacgcgggactttctgtcccagccgcgcctcacttataaaacc
gtgtctggtgtgaatggccccctggttatcttggatcaagtgaagtttcctaggtacgcg
gagattgtccacttgactcttcctgatggcaccagaagaagtgggcaggttctggaagtc
agtggctccaaagctgtggttcaggtatttgagggcacttcaggtattgatgctaagaaa
acatcctgtgagtttactggggacattcttcgaacccctgtctctgaagatatgcttggc
agagtatttaatggatcaggaaaacccatagacagaggccccgctgttttggctgaagac
ttcctggatataatgggtcagccaatcaatccccagtgtcgaatctatccagaagagatg
attcagactggcatttctgcaatagacggtatgaacagcattgccagggggcagaaaatc
cccatattctctgctgctggtttgccccacaatgagattgcagctcagatctgtcgccag
gctggcttggtgaagaaatccaaagatgtgatggattacagtgaagaaaattttgccatc
gtgtttgctgctatgggtgtgaacatggaaactgctcggttcttcaaatcagactttgag
gaaaatgggtccatggacaacgtgtgtctgttcttgaatttggccaatgacccaaccatt
gaacgcattatcacacctcgtctggctctaacaacggcagagttcttggcatatcagtgt
gagaagcatgtgctggtcattctgacagatatgagctcctatgctgaagctctacgagag
gtctcagcagctagagaggaggtacctggccgtcgtggtttcccaggttacatgtacact
gacttggctactatatatgaacgtgctgggcgtgtggaaggcagaaatggctcaattact
cagattcccattcttaccatgcccaatgatgatattactcatcctatccctgacttgact
ggatacatcactgagggacaaatctatgtggataggcagctgcacaacagacagatttac
ccacctattaatgtactgccctccttgtctcgactgatgaagtcagctattggagagggc
atgaccaggaaggatcatgcagatgtatccaaccaactgtatgcctgctatgctattggg
aaggacgtgcaggccatgaaggctgtagttggtgaggaagctcttacctcagatgatctt
ctttatctggagtttctgcagaagtttgagaagaacttcattgctcagggtccttatgaa
aatcgtactgtttacgagaccttggacattggatggcagcttttgcgaatcttccccaag
gagatgttgaagagaattccccaaacaacactggctgaattctatcctcgagattcgact
gcaaaacactaa

DBGET integrated database retrieval system