KEGG   Gallus gallus (chicken): 395502
Entry
395502            CDS       T01006                                 

Gene name
HOXB3
Definition
(RefSeq) homeobox protein Hox-B3
  KO
K09303  homeobox protein HoxA/B/D3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395502 (HOXB3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    395502 (HOXB3)
SSDB
Motif
Pfam: DUF4074 Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 395502
NCBI-ProteinID: NP_990074
CGNC: 49352
Ensembl: ENSGALG00000043219
UniProt: A0A1D5NXL9
Position
27
AA seq 399 aa
MQKTTYYESSTLFGGYSYGSTNGFGYEGPQQPFQPGSHVENDFQRSACSLQSLGNTTQHA
KSKDLNGSCMRPSLPQEHHPPPTVSPPPNPTTNSTSSNSNNQSGSSKSAPSKANLSANAS
LTKQIFPWMKESRQNSKQKSSSPSTETCSGEKSPPGSSASKRARTAYTSAQLVELEKEFH
FNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKSKGMGSSSGGPSPTGSPPQP
MQSSAGFMNALHTMSSNYDAPSPPSFNKPHQNAYAMSTNYQNPIKGCPSQQKYTNTAPEY
DPHVLQGNGVAYGTPSMQGSPVYVGGNYVDSLPTSGPSLYGLNHLPHHQAANMDYSGPPQ
MPPSQHHGPCEPHPTYTDLSSHHASSQGRIQEAPKLTHL
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgcagaagacaacgtactacgaaagctccacgctctttgggggctattcctatgggagc
accaatgggtttggctacgagggtccccagcagcccttccaaccgggttcccacgtggag
aacgacttccagaggtccgcctgctccctccagtctctcggcaacacaactcagcacgca
aaaagtaaagacctgaatgggagctgtatgaggccgagtttgccccaggagcaccatccg
cctccgactgtctcaccacccccaaaccccaccaccaacagcaccagtagcaacagcaat
aaccagtcagggagcagcaaaagtgccccgagtaaagccaacctcagtgcaaacgccagt
ctcaccaagcagattttcccctggatgaaagaatcgaggcaaaactcgaaacagaaaagc
agctcccctagcacagaaacctgcagcggcgagaaaagccctccaggctcctcggcctcc
aagagagcccgcacagcttacaccagcgcgcagctggtggagctggagaaggaattccac
ttcaaccgctacctgtgccggccccggcgcgtggagatggccaacctgctgaacctcagc
gagaggcagatcaagatctggttccagaacaggaggatgaagtataagaaagatcagaag
tcaaaagggatgggctcttcctctggagggccttcccccaccggcagccccccccaaccc
atgcaatcctccgccgggtttatgaacgccttgcacaccatgagcagtaactatgatgcc
ccctccccaccttccttcaataagccccaccaaaatgcctacgccatgtcaactaactac
caaaaccccatcaaaggctgcccctcccaacagaagtacaccaacacggcccccgagtac
gacccccatgtattacaagggaacggggtggcctacgggactcccagcatgcagggaagt
cccgtctacgttggaggtaactatgtggactccctgcccacctctggcccatccctttac
ggcctcaatcacctcccacatcaccaggcggccaacatggactacagtgggcccccgcag
atgcctccaagccaacaccacggaccatgcgagccccaccccacctacacagacctttcc
tcgcaccacgcatcttctcagggcagaatccaggaggcccccaagctgacccacctgtga

DBGET integrated database retrieval system