KEGG   Gallus gallus (chicken): 395503Help
Entry
395503            CDS       T01006                                 

Gene name
RUNX1T1
Definition
(RefSeq) protein CBFA2T1 isoform 2
  KO
K10053  CBFA2/RNUX1 translocation partner 1
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: NHR2 TAFH zf-MYND DUF4434 DUF3731 MAJIN Efg1
Motif
Other DBs
NCBI-GeneID: 395503
NCBI-ProteinID: NP_001290393
CGNC: 11885
Ensembl: ENSGALG00000033091
UniProt: Q5IJ76
Position
2
AA seq 577 aa AA seqDB search
MPDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTAL
NGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGER
VRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNP
AQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRP
CTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPNHRDLRDRN
RPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVKKTRRSLTVLRRCQEADRE
ELNYWIRRYSDAEDLKKGGNSSSSHSRQQSPVNPDPVTLESHREFLHRPASGYVPEEIWK
KAEEAVNEVKRQAMAELQKAVSEAERKAHDMITSERAKMERTVAEAKRQAAEDALAVINQ
QEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGETPAVS
SSVTPSSGAGSPIDTPPAATPRSTTPGTPSTIEATPR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcgcactgagaagcattccacaatgccagactcacctgtggatgtgaagaca
caatccaggctgacgcctccaacaatgccacctcctcccactacccaaggagctccaaga
acgagttcattcacgcccacaacgttaaccaatggcacaagccattcaccaacagcgtta
aatggagctccatctcctcctaatggctttagcaatgggccatcctcttcctcttcctct
tctctggctaaccagcagttaccaccagcttgtggagctaggcagctcagcaaactgaag
agatttcttacaaccttacagcagtttggcaatgacatttcaccagagattggggagaga
gtgcgtacccttgtgctaggacttgtgaattctactttgacaattgaagaatttcattcc
aaactgcaagaagctactaacttcccactgcgaccttttgtcatcccatttttaaaggcc
aatctgcccctgctgcagcgggagctgctgcactgtgcaaggctagccaagcagaaccca
gcccagtacctcgcccagcacgaacagctgcttctggatgccagcaccacctcacctgtt
gactcctcagagctgcttctcgatgtgaacgaaaacgggaagaggcgaactccagacaga
accaaagaaaatggctttgacagagagcctttgcactcagagcatccaagcaagcggccc
tgcactattagcccaggccagcggtacagtccaaataatggcttatcttatcagcccaat
ggtctgcctcatcccaccccacctccacctcagcattatcgtttggatgatatggccatt
gcccaccactacagggactcatacagacaccccaaccacagggacctcagggacagaaac
agacctatggggttgcatggcacacgtcaagaagaaatgattgatcacagactaacagac
agagaatgggcagaagagtggaaacaccttgaccatctgttaaactgtataatggacatg
gtgaaaaaaactaggcgatctctcactgtacttcggcgatgtcaagaagcagaccgtgag
gagctgaattactggatacggcggtacagtgatgcagaagatttaaaaaaaggtggtaac
agcagcagcagtcattccagacagcagagtccggtgaatccagatccagttacattagaa
tcgcatcgggaattccttcacaggcctgcatctggatatgtgccagaggagatctggaag
aaagctgaggaagctgtcaatgaagtaaaacgtcaggcaatggcagagttgcagaaggca
gtgtcagaagccgagcggaaagctcacgacatgatcacttccgagagagccaagatggag
cgcaccgttgccgaagccaagcgccaggctgcagaggatgcactagctgttatcaatcag
caggaggattcgagcgagagttgctggaactgtggccggaaagctagtgaaacctgcagt
ggttgcaacacagcacgatactgtggctcgttttgccagcacaaggactgggagaagcac
caccacatctgtggacagaccctccaagcccagcagcaaggagagacaccagcagtgagc
tcctcagtgacgcccagcagcggggccgggagccccatcgacaccccaccagcagccact
cctaggtccaccaccccaggaaccccgtccaccatagaggcgactcctcgctaa

DBGET integrated database retrieval system