KEGG   Gallus gallus (chicken): 395512
Entry
395512            CDS       T01006                                 

Gene name
EBF1
Definition
(RefSeq) transcription factor COE1
  KO
K09103  early B-cell factor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395512 (EBF1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    395512 (EBF1)
SSDB
Motif
Pfam: COE1_DBD COE1_HLH TIG HLH
Other DBs
NCBI-GeneID: 395512
NCBI-ProteinID: NP_990083
CGNC: 49357
Ensembl: ENSGALG00000003699
UniProt: A0A1D5NYJ1
Position
13
AA seq 591 aa
MFGIQESIQRSGSSMKEEPLGAGMNAVRTWMQGAGVLDASTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLV
WSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQ
KVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ
LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATSQGFTRNSSSVSPHGYVPSTTPQQTN
YNSVTTSMNGYGNAGMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGI
FSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgtttgggatccaggaaagcatccagcggagcgggagcagcatgaaggaggagcccctc
ggcgcggggatgaacgcggtgcggacgtggatgcagggagcgggcgtcctggacgccagc
acggccgcgcagagcggagtgggtctggcccgggctcacttcgagaagcagcctccttcc
aacctgaggaagtccaactttttccacttcgtcctggctctgtatgaccggcaggggcag
cccgtggagatcgagcgcaccgccttcgtgggcttcgtggagaaggagaaggaagctaac
agcgaaaagaccaacaacgggatccactaccgcctgcagctgctctacagcaatgggatc
aggacggaacaggatttctacgttcgcctcatcgactccatgaccaagcaggcgatagta
tatgaaggccaagacaagaaccccgaaatgtgccgagttctgctcacgcacgaaataatg
tgcagccgctgttgtgacaagaaaagctgtggcaacagaaatgagactccatcagatcca
gtgataattgacaggttcttcttgaaattttttctcaaatgtaaccaaaattgtctaaaa
aatgcaggaaaccctcgagacatgcgacgatttcaggttgtggtgtctacaacagtcaat
gttgatggccatgtgttggcagtgtcggacaatatgtttgtgcacaacaattccaagcat
gggcggagagctcgaagactcgatccttcggaaggtacgccttcttatctggaacatgct
acaccatgtatcaaagccatcagtccaagtgaaggatggactacaggaggtgccactgtc
atcatcataggagacaatttctttgatgggttacaggtcatcttcggcaccatgctggtt
tggagtgagctgattactcctcatgccatccgcgtacagacacctccccgacatatccca
ggggttgtagaagtcacattgtcctacaagtctaagcagttttgcaagggaacgcctgga
agattcatttacacagctctgaacgaacccaccattgactatggtttccaaaggttacag
aaggttatcccccggcaccctggtgaccctgaacgcttgccaaaggaagtaatacttaag
agggctgctgatttagtagaagcactctacggtatgccacataataaccaggaaataatc
ctgaaaagagcagcagacatcgcagaagcactctacagtgtccctcgcaatcataaccag
ctccccgcccttgctaacacgtcagtccacgcaggaatgatgggagtgaattcctttagt
ggtcaactagctgtcaacgtatccgaagcctcacaggccaccagtcagggttttactcgc
aactcaagcagcgtgtcacctcacggctatgtgccaagcaccacccctcagcagacaaat
tacaactctgtcacaacaagcatgaatggctatgggaatgctggaatgtcaaatttaggc
ggttctccaaccttcctgaatggatctgctgccaattctccctatgccattgtgccatca
agtccaacaatggcctcctccactagcctcccgtccaactgtagcagttcgtctgggatt
ttctcgttctcaccagccaacatggtctcagcagtgaaacagaagagtgcttttgcgcct
gtcgtgagaccgcaaacttctcctcctcccacctgcaccagcaccaacggcaatagcctg
caagctatatctggcatgattgttccccccatgtga

DBGET integrated database retrieval system