KEGG   Gallus gallus (chicken): 395514
Entry
395514            CDS       T01006                                 

Gene name
EIF5B
Definition
(RefSeq) eukaryotic translation initiation factor 5B
  KO
K03243  translation initiation factor 5B
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    395514 (EIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gga03012]
    395514 (EIF5B)
Translation factors [BR:gga03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    395514 (EIF5B)
SSDB
Motif
Pfam: GTP_EFTU IF-2 GTP_EFTU_D4 GTP_EFTU_D2 MMR_HSR1 Roc ATP_bind_1 RsgA_GTPase
Other DBs
NCBI-GeneID: 395514
NCBI-ProteinID: NP_001033585
CGNC: 12572
Ensembl: ENSGALG00000016764
UniProt: Q9W6Q4 E1BVP1
Position
1
AA seq 1220 aa
MGKKQKNKSEDSAKDDIDIDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILK
ELEELSIEAQGGKADREPSTGKVENDNEDSLSKQDKKRKGKSKKANLENDYDSEEMEDKD
RKSKKTQKAKQDVLSGSDDDDLEIQPKKNKGKTQKSNKKHELSEDEANVKKSKERVGTLS
TGESGDESDEFSQPRKGQKKNQKPKSTAALGSGDEEEESSFKVKTVAQKKAEKKERERKK
REEEKAKLRKLKEKEELEGGKEAAKPKEAPKKAEEKASPDVAAAPGPGGKGEIPAGAEAD
DNEGDKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAKMKEEEERAKREEEERIR
RLEELEAKRKEEERLEQERKERKKQKEKERKERLKKEGKLLTKAQREARARAEATLKLLQ
AQGVEVPSKDSVPKKRPIYEDKKKKKQQQPENKEVSESLEVTSPAEDAVELETLVKEEPP
LPAEPEEKEEEEEDDGGLDDWEAMVSDEDEEKESKPVHIEVKEQNEVDEEEEEEEEDEEE
EEEESEESDDAESEGSEDEDEKTSDERDADSQATGKQSVEKKPSKEISSDSEYDSDDDRT
KEERAYDKAKRRIEKRRAENSKNANTEKLRAPVICVLGHVDTGKTKILDKLRHTHVQDSE
AGGITQQIGATNVPLEAINEQTKMVKNFDRENIKIPGMLIIDTPGHESFSNLRNRGSSLC
DIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDTDVAVTLKKQK
KNTKDEFEERAKAIIVEFAKQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIALLVE
LTQTMLTKRLAECQELRAQVMEVKALPGMGTTIDVILINGRLREGDTIIVPGVEGPIVTQ
IRGLLLPPPMKELRVKNQYEKHKEVVAAQGVKILGKDLEKTLAGLPLLVAHKEDEVPVLK
DELIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMK
ASVMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQK
QEEFKHIAVFPCKMKILPQFIFNSRDPIVMGVVVEAGQVKQGTPMCVPSKNFVDIGIVTS
IEINHKPVEVAKKGQEVCVKIEPIPGESPKMYGRHFEATDILVSKISRQSIDALKDWFRD
EMQKSDWQLIVELKKVFEII
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgggcaagaagcagaagaacaagagcgaggacagtgcaaaagatgatattgatattgat
gcccttgctgctgagatagaaggtgcaggcgctgcaaaagaacaagagcctcagaaatcc
aaaggcaaaaagaaaaaagaaaagaagaaacaagattttgatgaagatgatatcctgaag
gagctggaagaactgtcaatagaggcacaaggagggaaagctgacagggaaccttctaca
ggaaaggttgaaaatgacaacgaagatagcttatcaaaacaggacaaaaaaaggaaagga
aagagcaaaaaagccaatcttgaaaatgactacgacagtgaggaaatggaagataaagat
agaaaatctaaaaaaactcagaaagcaaaacaagatgtactttctggcagtgatgacgat
gatcttgagattcagcctaagaaaaacaaagggaaaactcagaagtcaaacaaaaagcat
gaactgtcagaggatgaagctaacgttaagaaaagcaaagagcgtgtggggacgttgtct
acaggtgagagcggtgacgaatcggatgagttctcccagcctagaaaaggacaaaagaaa
aaccaaaaacccaagtccactgctgctcttggaagtggggatgaggaagaagaatcatcg
ttcaaagtaaaaacggtagcccaaaagaaggcagaaaaaaaagaacgtgaaaggaaaaaa
cgtgaggaagaaaaagccaaactgaggaaactgaaggagaaggaagaattagaaggtggc
aaagaagcagcaaagccaaaggaagctccaaaaaaggctgaagagaaggcctctcctgat
gtcgcagcagcccctggccctgggggaaaaggagaaattcctgcaggagcagaggctgat
gacaatgaaggggacaagaagaaaaaagacaagaaaaaaaagaaaggtgagaaagaggaa
aaggaaaaagagaagaagaaggggcccagtaaagctacagttaaagctatgcaagaagcc
ttagctaaaatgaaagaagaggaggagagggcgaaaagagaagaggaggaacgcataaga
cgactggaggagttagaagctaagcgcaaagaagaggaacgattggaacaagaaagaaaa
gaaagaaagaaacagaaagaaaaggagaggaaggaacgtctgaagaaggagggaaagctt
ttaacaaaagctcaacgagaagccagagccagggcagaagctactcttaaactactccaa
gctcagggtgttgaagtgccatccaaagactctgtgccaaagaagaggccaatatatgaa
gacaaaaagaaaaagaagcagcagcagccagaaaataaagaagtttcagaaagcttagag
gtgacttccccagctgaagatgctgtagaactagaaacactggtaaaagaagagcctcct
cttccagcagagccagaagaaaaggaggaagaagaagaagatgatggaggcttggatgac
tgggaagccatggttagcgatgaagatgaagaaaaagagagcaaacctgttcacattgaa
gtcaaagaacaaaatgaagtagatgaggaagaagaagaggaggaagaagatgaagaggaa
gaagaggaggagagtgaagaatctgatgatgcggaaagtgaagggagcgaagatgaggat
gagaagacttcagatgagagggatgccgattcccaagctactggaaaacaatctgtggaa
aaaaaacccagcaaggaaattagctctgattctgagtatgactcggatgatgaccgcacc
aaggaagagcgtgcttatgacaaagctaaacggagaattgagaaacgtcgagctgaaaac
agcaaaaatgccaacactgaaaagctgagagcaccagttatttgtgtcctagggcacgta
gacacaggcaagaccaaaattttagataagctccgccatactcacgtgcaggacagtgaa
gctggtggcatcacccagcagataggtgcgactaatgtgccccttgaagctatcaacgaa
caaactaagatggtgaaaaattttgacagagagaacataaaaattccaggaatgctgata
attgacactccaggacatgagtctttcagcaatttaagaaatagaggaagctcactttgt
gacattgccattctcgtagttgacattatgcatggtttggagccacagacaattgaatcc
ataaacctgttgaaatctaagaaatgcccctttattgtagctctcaacaagattgatagg
ttatacgactggaaaaaaagtcccgatacagatgtagctgtgactttaaagaagcagaaa
aagaatacaaaagatgagtttgaagaacgtgcaaaagctatcatagtggaatttgcaaaa
cagggtttgaatgctgccttgttttatgagaataaggatccccgcacttttgtttctctt
gtacctacctctgctcacacaggggatggcatgggaagtctgatagctcttctcgttgag
ctaacgcaaactatgctgaccaagagattggctgaatgtcaagaactgagagctcaagtc
atggaggttaaagcactgccaggcatgggcactaccatagatgttattttaattaatgga
cgcctgagagagggagacaccattattgttcctggtgtagaaggtcccatagtgactcag
attagaggtcttctgctacctcctcctatgaaggagctacgagttaagaaccaatatgaa
aagcacaaagaggtcgttgctgctcaaggtgtgaagattcttgggaaagatttggaaaaa
acattggctggtttgccattgcttgtagctcataaagaggatgaagtcccagtccttaag
gatgaactgatacatgaactgaagcaaacactgaatgcaatcaagttagaagagaaaggt
gtttatgtccaggcttctactttagggtctttggaagcattacttgaatttcttaaaacg
tcggaagtgccatatgcaggaattaatataggtcctgtccataaaaaagacgttatgaag
gcatccgttatgttggagcacgacccacaatatgcagtcatcctggcatttgatgtgagg
atcgaacgtgacgcgcaggaaatggctgatagtttaggagtgcgaatttttagtgctgaa
ataatttatcacttatttgatgccttcacaaaatatagacaagactacaaaaaacaaaaa
caagaagaattcaagcatatagcagtatttccttgcaagatgaaaatactccctcagttt
attttcaattcccgtgacccaatagtgatgggtgtggttgtggaggcaggccaggtgaaa
caggggactcccatgtgtgtacccagcaaaaactttgttgacattggaatagttacaagt
attgaaataaaccacaagccagtggaggtggcgaaaaaaggccaagaagtgtgtgttaaa
atagaacctattcctggtgaatcaccgaaaatgtatggacggcattttgaagcaacagac
atcctcgtcagtaagatcagccgtcagtccatcgacgctctgaaggactggttcagggac
gaaatgcagaagtctgactggcagctcatagtggagctgaagaaagtgtttgaaatcatc
tag

DBGET integrated database retrieval system