KEGG   Gallus gallus (chicken): 395522
Entry
395522            CDS       T01006                                 

Gene name
CHRNA9
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-9 precursor
  KO
K04810  nicotinic acetylcholine receptor alpha-9
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    395522 (CHRNA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    395522 (CHRNA9)
Ion channels [BR:gga04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   395522 (CHRNA9)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF5665
Other DBs
NCBI-GeneID: 395522
NCBI-ProteinID: NP_990091
CGNC: 10631
Ensembl: ENSGALG00000014268
UniProt: Q9PTS8
Position
4
AA seq 484 aa
MKRNNLSSFYVSLWLLFTATMLQAVESAKGKYAQMLFNELFEDYSNALRPVEDTDKVLNV
TLQITLSQIKDMDERNQILTAYLWIRQSWYDAYLKWDKDKYDGLDSIRIPSNLVWRPDIV
LYNKADDDFSEPVNTNVVLRYDGKITWDAPAITKSSCVVDVSYFPFDSQQCNLTFGSWTY
NGNQVDIINSLDSGDLSDFVEDVEWEIHGMPAVKNVITYGCCSEPYPDVTFTLILKRKSS
FYIFNLLLPCILISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAEIMPPSENVPL
IGKYYIATMTMITASTALTIIIMNVHHCGSEAKPVPQWARVVILDYMSKIFFVYDVGENC
TSPRREKEQEHRLEGGDMCRGGDGKSHLSSRNDDSDLKENLNGNWNKSFGVHGENVRENV
NCCSCYKMLIKNIEYIANCVRDHKANRAKGIEWKKVAKVMDRFFMWIFFIMVFFMSVLII
GKAA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaagagaaataacctgtcatccttttatgtctctctctggttgctgttcacagccacg
atgcttcaagctgtagaatcagccaaagggaaatatgctcagatgctgttcaatgaactg
tttgaagactattcaaatgctctaagaccagtggaagacacggataaagtgctgaacgtt
acccttcagataacattgtcccaaattaaagatatggatgaaaggaaccaaattttgaca
gcttacttatggattcgacaaagctggtatgatgcatacctcaaatgggataaggataaa
tatgatggattggattctatcagaattccaagcaatttggtctggaggccagatattgtc
ctctataacaaggctgatgatgacttttcagaacctgtgaatactaatgttgtgttgaga
tatgatggaaaaatcacttgggatgcacctgctatcacaaaaagctcgtgtgtagtagat
gtatcttattttccttttgacagccagcagtgcaaccttacgtttggttcctggacctat
aatggtaatcaggtagacatcatcaattctctcgatagtggtgacctttctgactttgta
gaagacgtggaatgggagattcatggtatgccggcggttaagaatgtaatcacttacggc
tgctgctctgagccttatccagatgtaacgttcacgctgattttgaaaaggaagtcatct
ttctacatatttaatcttctgcttccttgcattttgatctctttcctcgctccactggga
ttttatctccccgcagactctggagaaaaagtgtctctaggtgttacagttcttcttgct
ctgactgtgttccagctgatggttgcagagattatgcctccctctgaaaacgtacctctg
ataggcaagtattacatagcaactatgaccatgatcacagcctccactgcgctgacaatc
attataatgaacgtccatcactgtggctcagaagcaaagcctgtcccacagtgggccaga
gtggtaatcttggactatatgtcaaaaattttttttgtttatgatgtgggtgaaaactgt
acaagtccacgaagagagaaggaacaagaacacaggttagagggtggtgacatgtgtcgg
gggggagacggaaagagccacctttccagtagaaatgatgacagtgatctcaaagaaaat
ctgaatggaaattggaataaaagctttggagttcatggtgaaaatgttagggagaatgtt
aattgctgttcctgttacaaaatgctgattaaaaatattgagtatattgcgaattgtgtt
cgagaccataaagcaaaccgggccaaaggaattgagtggaaaaaggtggcaaaggtgatg
gacaggtttttcatgtggattttttttatcatggtgttttttatgagcgtgcttatcatt
gggaaagcagcttag

DBGET integrated database retrieval system