KEGG   Gallus gallus (chicken): 395531
Entry
395531            CDS       T01006                                 

Gene name
NID1
Definition
(RefSeq) nidogen-1
  KO
K06826  nidogen (entactin)
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    395531 (NID1)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 EGF-like domain-containing proteins
  cEGF domain-containing proteins
   395531 (NID1)
SSDB
Motif
Pfam: G2F Ldl_recept_b EGF_3 NIDO cEGF Thyroglobulin_1 EGF_CA FXa_inhibition EGF EGF_MSP1_1 SGL
Other DBs
NCBI-GeneID: 395531
NCBI-ProteinID: XP_025004864
CGNC: 8345
Ensembl: ENSGALG00000042079
Position
3
AA seq 1207 aa
MEVDWESASELFSCSSEPESRQVATNGIIAVNEPKNEEKYLGQFPVSFGAIAPFMADLDT
TDGRGNVYYREDSSSDVLQLASDYIKGGFPEATFDPSSAVIVTWKLVAPYHGPGEDLTLE
EKRNTFQAVLASSDSSSYAIFLYPEDGLQFYSAYSKNDDGKIPAMVGFSQASTNYYFWEN
PGSYNVIANDEDSIRNLHKSSNAGRQGVWVFEIGSSSDTIVPAKVSSVLASLEPSEEDQE
LTSKPFMSDYGSTEIRPQYVTSSTDSIEEDQHVTYSVPQLAVEDFITSYQDVTGTPSTES
FYRHREFPTAKAPPRQFPAQQFPPQGPQVIDVEEFDETGIVFRYHTDVQQTCANNRHQCS
VHAICKDYPNGFCCSCIAGYKGNGRQCVAEGSPQRVNGKVKGRVFVGNNPVPVTFENTDL
HSYVVMNHGRAYTAISTIPEALGYSLLPLASIGGVIGWMFAVEQQGYKNGFSITGGEFTR
QTEVTFLGNNEKLVIKQKFSGIDEHGHLTISTEMEGRVPEVPSGASVHIEPYTELYHASS
SVITSSSTREYTVTEPERDGVASTYTGAYQWRQTISFDECIHDDSLHAASATQQLSVDSI
FVLYNRDEQILRYAMSNSIGPISDGSADISRNPCYTGTHNCDTNAVCRAGTGNRFSCECS
IGFRGDGNVCYDIDECSEQPGLCGSNAVCNNQPGTYRCECVDGYQFAADGRTCVAVEYAI
NHCQTGTHGCDIPQRAQCVYTGGSAYICTCLPGFSGDGRACEDIDECQQGHCHPDAFCYN
TPGSFSCQCKAGYRGDGFQCVLGGVVKTKCQHEKEVALGSGGTFFQREIRVGQFIPQCDE
HGNYVPTQCHGSTGYCWCVDRDGNEIDGTRSGPGVRPPCLSTAAPPVGIGPSVRPDTIPL
PPGTHLLFAQSGKIEHVPLEGNNMKKNGAKALLHIPDKVIIGVAYDCMDKMVYWTDISGP
SISRASLHGGEPTTIIRTDLGSPEGIALDHLGRNIFWTDSQLDRIEVARLDGRQRRILFD
TGLVNPRAIVVDPVRGNLYWTDWNREAPKIETSYMDGTNRRILVKDDLGLPNGLTFDPYS
SMLCWVDAGTKRLECMNPNQLGRRKIVEGIQYPFGVTSYGKNLYYTDWRRDAVVAVDRMI
SVENDNFQPHKRSRLYGITTAFAQCPGGHNYCTVNNGGCTHLCLATPEGRSCRCPDNTVG
VDCIERN
NT seq 3624 nt   +upstreamnt  +downstreamnt
atggaggttgactgggaaagtgcatctgaactcttctcttgttcttctgaacctgaaagc
cgtcaggttgccacaaatgggattattgcagtgaatgaacctaagaatgaagaaaaatat
cttggccaattcccagtcagttttggggctattgctccttttatggctgatctggataca
acagatggacgtggaaatgtttattacagagaagattcatcctcagatgtcttacaactt
gcatcagactatatcaaaggcgggtttcctgaggccacttttgatcccagcagtgctgtt
attgttacctggaagcttgtggctccataccacggacccggagaagatcttactttggaa
gaaaagaggaacacattccaggctgttctagcctcttctgactccagttcctatgctatt
ttcctttacccggaagatggtttgcagttctatagtgcgtactcaaagaatgatgatgga
aagattcctgcaatggttggctttagtcaggcctctacaaactactacttttgggaaaat
ccaggatcctacaacgttattgctaatgatgaagacagcattagaaacttgcacaaaagc
agcaatgctgggagacaaggtgtctgggtgttcgagattggtagctcatctgacactatt
gtgcctgccaaggtcagcagtgttctggcgagcctagagcccagtgaagaagaccaggag
ttgacttcaaaaccattcatgtcagactatggctccactgaaataagaccacagtacgtc
accagtagcacggacagtatagaagaggatcagcacgttacatacagtgttcctcagtta
gctgtggaggactttataacttcataccaagatgtaacaggaacaccttcaactgaatct
ttttatcgtcatcgagaattcccaacagcaaaagctccacctcgccagttcccagcccag
cagttccccccacagggaccccaggtcatagatgtggaagaatttgatgaaactggtata
gtgttccgctaccacacagacgtccaacagacctgtgctaacaatcgccaccagtgctct
gttcatgctatttgcaaagattaccccaatggattttgttgcagttgtattgctggatac
aaaggaaatggcagacagtgtgtagcagaaggttctcctcagagagtcaatgggaaagtc
aaaggacgagtcttcgtaggaaataaccccgttccagttacatttgagaacaccgatctc
cactcgtatgttgtgatgaaccacggacgtgcctatactgctatcagcacaatcccagaa
gctttgggttattctttactgcctcttgcctctattggaggcgtaatagggtggatgttt
gctgtggagcagcaaggatataaaaatggattcagcattaccggtggggagtttacacgg
caaactgaagtcacttttcttggcaacaacgagaagctggttataaagcagaagttcagt
ggaattgatgagcacggtcatcttaccatcagcacagaaatggaaggcagagtacctgag
gtcccttctggcgcatcagtccatattgaaccttacactgaactctatcacgcctctagt
tctgtgatcacttcatcgtccaccagagagtacacagtgacagagccagaaagggatggg
gttgcttccacgtacactggtgcctatcagtggcgacagaccatctcctttgatgaatgc
attcatgatgactctctccatgctgcttctgctactcagcagctctcagtggacagtata
tttgttctgtataacagagatgaacaaattctgcgatatgctatgagcaattccattggc
cccatcagtgatggttctgctgatattagccggaatccttgctacactggtacccataac
tgtgacaccaatgcagtatgtcgtgcaggaactgggaatcgtttctcttgtgaatgttcg
attggattccgtggagatggaaacgtttgttatgatattgatgagtgttcagagcaaccg
ggtctatgtggcagcaatgcagtttgcaataaccagccgggaacgtaccgatgcgagtgt
gttgatggataccagtttgcagcagacgggcggacttgtgttgctgttgaatatgccata
aaccactgccagacaggcacacatggctgcgacatccctcagcgggctcagtgcgtgtac
actggtgggtctgcctacatctgcacatgcctccctggcttctctggagatgggcgtgcc
tgtgaggatatagatgaatgtcagcagggccactgtcatccagatgctttctgctacaac
acacccggatccttcagctgccagtgtaaggcaggttatcgtggggatggtttccagtgt
gtgttaggaggagtggtaaagaccaaatgccagcacgagaaagaagtagctcttggaagt
ggaggcactttcttccaaagagaaataagagttggtcagttcattccccagtgtgatgaa
catggaaattacgtacccactcagtgccacggcagcactggatattgttggtgtgtggat
agagatggaaatgagattgacggcaccagaagtggccctggagttcgaccaccatgtctg
agcacagctgctcctcctgttggtattgggccctctgttcgaccagacacaataccactg
cctccaggaacacatttgctttttgcccaaagtgggaaaattgaacatgttccactggag
ggaaacaacatgaagaaaaatggtgcaaaagcactcttgcatattccagacaaagttatt
attggagttgcttatgactgcatggacaagatggtttactggacagacatcagcggtccg
tccatcagtagagctagcctgcatggtggggagccaacgaccatcatcagaacagacctg
ggaagccctgaagggatagctctagatcatctaggtcgcaacatcttctggactgactct
caacttgatagaatagaagtggctagactggatgggcgccagcgtcgcatcctttttgac
actggcctggtgaacccccgtgcaattgttgtggatcctgtgagaggaaacttgtactgg
actgactggaacagagaagctcctaaaattgaaacttcatacatggatggcacaaacaga
agaattcttgtgaaggatgatctgggattaccaaatgggctgacatttgatccttactcc
tcaatgttgtgttgggtagatgcaggtaccaagagactggaatgcatgaaccctaatcag
cttggtcgacgaaagattgttgaaggaattcagtatccttttggtgttacaagctatggg
aagaatttgtactacacagactggagaagggatgctgttgtagctgtggatcgcatgatt
tcagtagaaaatgataacttccaacctcacaagcgctcccgtctctatggaatcactaca
gcttttgctcagtgcccaggaggacataactactgtacagtgaataatggtggttgtact
cacctctgcttggctacgccagaaggccgctcttgccgctgccctgacaacacagttgga
gtggattgtatagaaagaaactga

DBGET integrated database retrieval system