KEGG   Gallus gallus (chicken): 395532
Entry
395532            CDS       T01006                                 

Gene name
COL1A1
Definition
(RefSeq) collagen alpha-1(I) chain
  KO
K06236  collagen, type I, alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    395532 (COL1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395532 (COL1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395532 (COL1A1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   395532 (COL1A1)
SSDB
Motif
Pfam: Collagen COLFI VWC TILa
Other DBs
NCBI-GeneID: 395532
NCBI-ProteinID: XP_024999899
CGNC: 49364
Position
27
AA seq 1453 aa
MFSFVDSRLLLLIAATVLLTRGQGEEDIQTGSCVQDGLTYNDKDVWKPEPCQICVCDSGN
ILCDEVICEDTSDCPNAEIPFGECCPICPDVDASPVYPESAGVEGPKGDTGPRGDRGLPG
PPGRDGIPGQPGLPGPPGPPGPPGLGGNFAPQMSYGYDEKSAGVAVPGPMGPAGPRGLPG
PPGAPGPQGFQGPPGEPGEPGASGPMGPRGPAGPPGKNGDDGEAGKPGRPGERGPPGPQG
ARGLPGTAGLPGMKGHRGFSGLDGAKGEPGPAGPKGEPGSPGENGAPGQMGPRGLPGERG
RPGPSGPAGARGNDGAPGAAGPPGPTGPAGPPGFPGAAGAKGETGPQGARGSEGPQGARG
EPGPPGPAGAAGPAGNPGADGQPGAKGATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKG
NSGEPGAPGNKGDTGAKGEPGPAGVQGPPGPAGEEGKRGARGEPGPAGLPGPAGERGAPG
SRGFPGADGIAGPKGPPGERGSPGAVGPKGSPGEAGRPGEPGLPGAKGLTGSPGSPGPDG
KTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKPGERGAPGPPGAVGAAG
KDGEAGAQGPPGPTGPAGERGEQGPAGAPGFQGLPGPAGPPGEAGKPGEQGVPGDAGAPG
PAGARGERGFPGERGVQGPPGPQGPRGANGAPGNDGAKGDAGAPGAPGNQGPPGLQGMPG
ERGAAGLPGAKGDRGDPGPKGADGAPGKDGLRGLTGPIGPPGPAGAPGDKGEAGPPGPAG
PTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGETGDAGAKGDAGPPGPAGPTGAPG
PAGAVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNIGLPGPPGPSGKEGGKGPRG
ETGPAGRPGEPGPAGPPGPPGEKGSPGADGPIGAPGTPGPQGIAGQRGVVGLPGQRGERG
FPGLPGPSGEPGKQGPSGSPGERGPPGPMGPPGLAGPPGEAGREGAPGAEGAPGRDGAAG
PKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPPGPAGARGPAGPQG
PRGDKGETGEQGDRGMKGHRGFSGLQGPPGPPGAPGEQGPSGASGPAGPRGPPGSAGAAG
KDGLNGLPGPIGPPGPRGRTGEVGPVGPPGPPGPPGPPGPPSGGFDFSFLPQPPQEKAHD
GGRYYRADDANVMRDRDLEVDTTLKSLSQQIENIRSPEGTRKNPARTCRDLKMCHGDWKS
GEYWIDPNQGCNLDAIKVYCNMETGETCVYPTQATIAQKNWYLSKNPKEKKHVWFGETMS
DGFQFEYGGEGSNPADVAIQLTFLRLMSTEATQNVTYHCKNSVAYMDHDTGNLKKALLLQ
GANEIEIRAEGNSRFTYGVTEDGCTSHTGAWGKTVIEYKTTKTSRLPIIDLAPMDVGAPD
QEFGIDIGPVCFL
NT seq 4362 nt   +upstreamnt  +downstreamnt
atgttcagctttgtggattctcggttactgctgttgatagcagcgactgtactactcacc
cgcgggcaaggagaagaggacatccagaccgggagctgcgtccaggacgggctgacgtac
aacgataaggatgtgtggaaacccgaaccgtgccagatctgcgtctgcgacagcggcaac
atcctctgcgacgaggtgatctgcgaggacacctccgactgccccaacgccgaaatcccc
ttcggagagtgctgccccatctgccccgatgtcgacgcctccccagtctacccggagagt
gctggagtagagggtcctaaaggagacaccggccccagaggagacaggggactccccggc
ccccccggcagagatggcatccctggacagcctggcctcccgggacccccaggccctcca
ggacctccaggcctcggcggaaacttcgctcctcaaatgtcttacggctacgacgagaaa
tcggccggcgtggcggtgcccggccccatgggccctgcaggaccccgtggtctccccggc
cctcctggtgctcctggccctcaaggtttccaaggcccccctggtgaacccggcgagccc
ggagcctccggacccatgggcccccgcggccccgctggcccccctggcaagaacggcgat
gatggtgaagctggcaaacccggccgtcctggcgaacgcggcccccccggcccccagggc
gcacgtgggctccccggaactgccggtctgccgggcatgaagggacacagaggcttcagt
ggtttggatggtgccaagggtgagcccggccctgctggtcccaagggtgagcctggcagc
cctggagagaacggcgctcccggacagatgggtccccgcggtcttcccggcgagagaggc
cgccccggtccatccggtcccgctggcgctcgcggtaacgacggtgctcccggtgctgcc
ggtcctcccggcccgaccggtcccgcgggtccccccggcttccccggcgccgctggcgct
aagggcgaaacgggtccccaaggtgcccgcggtagcgaaggtccccaaggtgcccgtggc
gaacccggtccccccggcccagctggcgctgccggtcccgccggtaaccccggtgccgac
ggtcagcccggtgccaaaggtgctacgggcgctcccggcatcgccggtgcccccggcttc
cctggtgctcgcggtccctccggaccccaaggtcccagcggtgcccccggacccaaaggg
aacagcggtgaacccggtgctccgggcaacaaaggtgacaccggtgccaaaggcgaaccc
ggtcccgctggcgttcaaggcccccccggccccgccggcgaggaaggcaagagaggagcg
cgtggagagcccggccctgctgggctgcccggtcctgcgggcgaacggggcgcccccggc
agccgcggtttccccggtgccgacggcatcgccggtcccaagggcccccccggagagcgc
ggttcccccggcgccgtcggccccaaaggatctcccggtgaagccggccgtcccggtgaa
cccggcctccccggtgccaagggtctgactggaagccccggcagccccggtcccgacggc
aaaaccggacccccgggtcccgctggtcaggatggccgccccggcccccccggccccccc
ggagccagaggtcaagctggtgtgatgggtttccccggtcccaaaggtgctgcgggtgag
cccggcaaacccggagagagaggcgctcccggcccccccggcgctgttggtgctgccggt
aaggacggtgaagccggtgctcagggtccccccggccccactggtcccgctggagagaga
ggtgagcagggtcccgccggagcgcccggcttccagggtctgcccggtcccgctgggccc
cccggagaggcgggcaaacccggcgagcagggtgtccccggagatgccggtgcccccggt
cccgccggtgccagaggcgagagaggtttccccggcgagcgcggcgttcagggccccccc
ggcccgcagggcccgcgcggcgctaacggtgctcccggaaacgacggtgctaagggtgat
gccggtgctcccggtgcccccggaaatcagggcccccccgggctgcaggggatgcccgga
gagcgcggtgccgccggtctgccaggcgctaagggtgacagaggtgaccccggtcccaaa
ggtgctgacggcgctcctggcaaagacggtctccgtggtctcaccggccccatcggcccc
cccggccccgccggcgctcccggcgataagggtgaagctggcccccccggccctgcaggg
cccaccggtgcccgtggtgctcccggcgaccgtggcgagcccggccccccaggtcctgct
ggatttgctggccctcccggtgctgacggccagcctggtgctaaaggtgaaactggggat
gctggagccaaaggtgacgccggcccccctggccccgctggccccactggtgctcccggc
cctgccggtgctgttggtgctcccggtcccaaaggcgctcgcggaagcgctggaccccct
ggtgctactggtttccctggtgctgctggaagagtcggtccccccggcccctccggtaac
atcggccttcccggcccccccggccccagcggtaaggaaggtggcaaaggaccccgtggt
gagaccggccccgctggccgccccggtgaacccggccctgctggcccccccggccccccc
ggcgagaaaggctcccccggcgccgacggccccattggcgctcccggcacccccggaccc
caaggtatcgccggtcagcgcggtgtcgtcggtctccccggacagagaggcgagagaggc
ttccccggcctgcccggcccctctggcgaacccggcaagcagggtccctccggatccccc
ggtgaacgcggtcctcccggccccatgggcccccccggccttgctggcccccctggtgaa
gctggacgtgagggtgctcccggtgccgaaggtgcccccggtcgtgacggtgctgccggt
cccaagggtgaccgtggtgagacgggccctgccggcccccctggtgctcccggtgccccc
ggtgcccccggccccgtcggtcctgctggcaaaaatggagatcgcggtgagaccggcccc
gctggtcccgccggcccccctggtcccgctggtgctcgtggtcctgctggtccccaaggt
cctcgcggcgacaaaggcgagaccggtgaacagggagacagaggcatgaagggccacaga
ggcttctccggtctccagggcccacccggtcctcccggcgctcctggtgaacaaggtccc
tccggtgcttccggtcccgccggtccacgcggtcctcctggctccgccggtgccgccggc
aaagacggtctcaatgggctgcccggccccatcggcccccccggcccccgcggtcgcacc
ggtgaagtcggccccgttggtccccccggccctcccggccccccgggtcctcccggcccc
cccagcggcggcttcgacttcagcttcctgcctcaaccgccccaagagaaggcgcacgac
ggcggccgctactaccgagccgacgacgccaacgtgatgcgcgaccgcgacctggaggtg
gacaccaccctgaagagcctcagccaacagatcgagaacatccgcagccccgaaggcacc
cgcaagaacccggcccgcacctgccgggacctgaagatgtgccacggcgactggaagagc
ggcgagtactggatcgaccccaaccagggctgcaacctggatgccatcaaggtctactgc
aacatggagacgggtgagacgtgcgtctaccccacgcaagccaccattgcccagaagaac
tggtacctcagcaagaaccccaaggagaagaagcacgtctggttcggcgagacgatgagc
gacggcttccagtttgagtacggcggtgagggctccaacccggctgatgtcgccatccaa
ctgaccttcctgcgcctgatgtccaccgaggccacccagaacgtcacctaccactgcaag
aacagcgtcgcctacatggaccacgacaccggcaacctgaagaaggctctgctgctccag
ggagccaacgagatcgagatcagggccgaaggaaacagccgcttcacctatggggtcacc
gaggatggctgcacgagtcacactggagcatggggcaaaacagtgattgagtacaagacg
acgaagacctcgcgcctgcccatcattgacttggctcctatggacgttggcgctccggac
caggaatttggcattgacatcggccccgtctgctttttgtaa

DBGET integrated database retrieval system