KEGG   Gallus gallus (chicken): 395533
Entry
395533            CDS       T01006                                 

Gene name
MEOX1
Definition
(RefSeq) homeobox protein MOX-1
  KO
K09322  homeobox protein MOX
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395533 (MEOX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Eve
    395533 (MEOX1)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 395533
NCBI-ProteinID: NP_990096
CGNC: 810
Ensembl: ENSGALG00000001191
UniProt: Q9YI38
Position
27
AA seq 240 aa
MDPTGGSCMRSPQPPAPLWGCLRGADVPTAPGLGHCPPTPFSFHPKADFAAYSEFSASCL
LSAAHCVPPEEQPPPFRPHPEWQQTATEARRLLSPGLALASGDAESPNLVSTAVAVSEDY
KVPVNSGMETERKASKRKKEHSESQPSSSKAEGSSRSRKERTAFTKEQLRELEAEFAHHN
YLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQPVSPPEPDAEDADSTTSPSSE
NT seq 723 nt   +upstreamnt  +downstreamnt
atggaccccaccggaggcagctgcatgcgcagcccccaacccccagccccactctggggg
tgcctacggggcgctgatgtccccacagccccagggttgggtcactgccccccgacccct
ttctccttccaccccaaggcggattttgctgcttattctgaattctcagcctcctgcttg
ctgagcgctgcccactgcgtcccacccgaggagcaaccgccaccgttccgtccccatcct
gagtggcagcaaacagcaacagaggcccggagactgctgagcccagggctggcgttggcc
tctggggatgcagagagccccaacctcgtgagcacagcagtggctgtaagtgaagattac
aaagtgccggtaaacagcgggatggagacggagagaaaggcatccaaaaggaaaaaggag
cactcagaaagccagccctccagcagcaaggcagaaggcagcagcaggtcgcggaaggag
aggacagcgttcaccaaggagcagctgagggagctggaggcagaatttgcccaccacaat
tacctgacaaggctcaggagatacgagatcgctgtgaacctggacctcaccgagagacag
gtcaaagtgtggttccagaatagaaggatgaagtggaagcgcgttaagggggggcaacca
gtgtcccctcctgagcccgatgcagaggacgccgactccaccacatcccccagctccgag
tag

DBGET integrated database retrieval system