KEGG   Gallus gallus (chicken): 395543
Entry
395543            CDS       T01006                                 

Gene name
SMAD9
Definition
(RefSeq) mothers against decapentaplegic homolog 9
  KO
K16791  mothers against decapentaplegic homolog 9
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395543 (SMAD9)
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Other DBs
NCBI-GeneID: 395543
NCBI-ProteinID: NP_001019997
CGNC: 12809
Ensembl: ENSGALG00000017050
UniProt: Q56I98
Position
1
AA seq 476 aa
MHSSTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMEELERALS
CPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK
QKEVCINPYHYRRVETPVLPPVLVPRHSEFNPHLSLLAKFRNTSLHSEPLMPHNATYPDS
FQHPPCTPFPPSPSHMFSQSPNSISYPNSPGSSSGPGSPYQLTVETPPPPYHARETPGSH
NGRSMDAIAESQLVLSLPNGGKSADGETENFRPVCYEEPQHWCSVAYYELNNRVGETFQA
SSRSILIDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVS
DSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKIFNNQLFAQPLAQSVNHGFEVVYELTKM
CTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgcactccagcacccctatcagttccttgttctccttcaccagccctgcagtgaaaagg
ctgctgggctggaaacaaggagatgaagaggaaaagtgggcagaaaaagctgttgattcc
ctggtgaagaaattaaagaagaaaaaaggtgccatggaagaactggaaagggctctaagc
tgcccaggtcagcccagtaaatgtgtcacgatcccacgttccttggatgggcggctgcag
gtttctcaccgcaaggggctccctcatgtcatatactgcagagtgtggcgttggcctgat
ttacaatctcaccatgaattgaagccactggaatgctgtgagttcccatttggctcaaaa
cagaaagaagtgtgcattaacccctaccattaccggcgggtggaaactccagtcctacct
ccagtacttgttccaagacacagcgagtttaaccctcacctcagccttctcgccaagttt
cgaaatacttctctgcacagtgagccactgatgccacacaatgccacctatcctgattct
ttccaacatcctccatgcaccccgtttccaccatcacccagccacatgttctcccagtcg
cctaacagcatcagctaccccaactcaccaggaagctcttctggaccaggaagtccatat
cagctcacggtggaaactccacccccaccctaccacgcaagagaaactccgggaagccac
aatgggcggtcaatggatgctatagctgaaagccaactagtactgtctttgcccaatgga
ggtaaatctgccgatggagaaactgaaaattttcggcctgtttgctatgaggagccacaa
cactggtgctcagttgcctactatgaactcaacaacagggtaggagagactttccaggct
tcctctcgaagtatccttatagatggatttacagatccctcaaataacaaaaacaggttc
tgcctgggactgctctcgaatgtaaaccgcaattcgactatagaaaacaccaggagacac
ataggaaaaggtgtccatctttattatgttggtggagaagtgtatgctgaatgtgtcagt
gacagcagtattttcgtgcagagccgcaattgtaactatcagcatggtttccacccagcc
actgtctgtaagatccccagtggctgcagcctcaagatcttcaacaaccagctcttcgcc
cagccgcttgcccagtcagtcaatcatggttttgaagtggtatatgagctgacgaagatg
tgtacgattcgaatgagctttgttaaaggctggggagcagagtatcatcgccaagatgtt
acaagcacgccctgctggattgagatccacctgcacggaccattgcaatggctggataag
gttctgacacagatgggctcacctcataaccccatctcttccgtctcttaa

DBGET integrated database retrieval system