KEGG   Gallus gallus (chicken): 395545Help
Entry
395545            CDS       T01006                                 

Gene name
FRZB
Definition
(RefSeq) secreted frizzled-related protein 3 precursor
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR
Motif
Other DBs
NCBI-GeneID: 395545
NCBI-ProteinID: NP_990103
CGNC: 1994
Ensembl: ENSGALG00000002763
UniProt: Q9IA95
Position
7
AA seq 315 aa AA seqDB search
MWRGLPALALAALLLLGRAPAGRAAACEPVRIPLCKPLPWNMTKMPNHLHHSTQANAVLA
MEQFEGLLGTNCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARAGCEPVLIRYRH
AWPESLACDELPLYDRGVCISPEAIVTAEGADFPMDSNNGNCRGTGIERCKCKPIKATQK
TYLRNNYNYVIRAKVKEVKTKCHDVTAVVEVKEILKSSLVNIPKDTVNLYTNSGCLCPPL
SANEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDQKLRHLGKGKGEPGQSDS
ALKTGKPGNARQTRS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggggctgccggcgctggccctggccgcgctgctgctgctggggcgggcgccg
gcggggcgggcggcggcctgcgagccggtgcgcatcccgctatgcaagccgctgccctgg
aacatgaccaagatgccgaaccacctgcatcacagcacgcaggccaacgccgtgctggcc
atggagcagttcgaggggctgctgggcaccaactgcagcccggacctgctcttcttcctc
tgcgccatgtacgcgcccatctgcaccatcgacttccagcacgagcccatcaagccctgc
aagtccgtctgcgagcgcgcccgcgccggctgcgagcccgtcctcatccgctaccgccac
gcgtggcccgagagcctggcctgcgacgagctgccgctctacgaccgcggcgtctgcatc
tcccccgaggccatcgtcaccgccgagggcgccgatttcccaatggattctaataatggc
aactgtagaggcactggcattgaacgctgcaaatgcaaacccataaaagctacccagaag
acctatctacgcaacaattacaactatgtcattcgagcaaaagtgaaggaggtgaagact
aaatgtcatgatgtcactgcagtagtggaagtaaaagagattctcaaatcttccctggtg
aacatcccaaaggacactgtaaacctttacacaaactccggctgcctctgtccaccactc
agtgccaatgaagagtacatcattatgggctacgaagatgaggagcgctccaggttactc
ttggtggaaggctccatagctgagaaatggaaggatcgacttggtaaaaaagtaaagcgc
tgggatcaaaagctccgccacctcggcaaagggaaaggagagccgggacaaagtgattcg
gcgctgaagactgggaagcccggcaatgcccggcaaactcgcagctag

DBGET integrated database retrieval system