KEGG   Gallus gallus (chicken): 395548Help
Entry
395548            CDS       T01006                                 

Gene name
PHOX2B
Definition
(RefSeq) paired mesoderm homeobox protein 2B
  KO
K09330  paired mesoderm homeobox protein 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395548 (PHOX2B)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    395548 (PHOX2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain TraC Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 395548
NCBI-ProteinID: XP_015140956
CGNC: 49370
Ensembl: ENSGALG00000014250
UniProt: F1NMR6
Position
4
AA seq 292 aa AA seqDB search
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSL
TPGSCSLGSLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAET
HYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGAAGKKSDASR
DDESKEAKSTDPDSTGGPGPNPNPAPSCGGGGGPSPAGGQGAAGPGGPGGEPGKGAAGPG
GLAAAGPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPGGTKGSLVKSGMF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatggaatattcttacctcaattcctccgcctacgagtcctgtatggccggg
atggacacctcgagcctggcttcagcgtatgctgacttcagttcctgcagccaagccagt
ggcttccagtataaccccataaggaccactttcggggccacctcaggctgcccgtccctc
actccaggatcctgcagcctcggctcgctcagggaccaccagagcagcccctacgcagca
gttccttacaaactcttcaccgaccacggcggtttgaacgagaagcggaaacagcggcgg
atccgcaccacgttcaccagcgcgcagctcaaggaactggagcgggtgttcgcggagacg
cactaccccgacatttacacccgggaggagctggcgctcaagatcgacctcaccgaggcc
cgagtgcaggtgtggttccagaaccgccgcgccaagttccgcaagcaggagcgggcggcg
gcggcggcggcggcggccgccaagaacggagcggccggcaagaagtcggacgcctcccgc
gacgacgagagcaaggaggccaagagcaccgaccccgacagcaccggcggccccgggccc
aaccccaaccccgcgcccagctgcggcggcggcggcgggcccagccccgcgggcgggcag
ggggcggcggggcccggcggcccggggggagagccgggcaaaggggcggcggggcccggc
gggctggcggcggcggggccggggcagggctgggccccggggcccgggcccatcacctcc
atccccgactcgttaggcggccccttcgccagcgtgctctcctcgctgcagcggcccggc
ggcaccaaaggcagcctcgtcaagagcggcatgttctga

DBGET integrated database retrieval system