KEGG   Gallus gallus (chicken): 395555
Entry
395555            CDS       T01006                                 

Gene name
MRE11
Definition
(RefSeq) double-strand break repair protein MRE11
  KO
K10865  double-strand break repair protein MRE11
Organism
gga  Gallus gallus (chicken)
Pathway
gga03440  Homologous recombination
gga03450  Non-homologous end-joining
gga04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    395555 (MRE11)
   03450 Non-homologous end-joining
    395555 (MRE11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    395555 (MRE11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gga03032]
    395555 (MRE11)
   03400 DNA repair and recombination proteins [BR:gga03400]
    395555 (MRE11)
DNA replication proteins [BR:gga03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     395555 (MRE11)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     395555 (MRE11)
    BRCA1-C complex
     395555 (MRE11)
   NHEJ (non-homologous end-joining)
    MRX complex
     395555 (MRE11)
SSDB
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Other DBs
NCBI-GeneID: 395555
NCBI-ProteinID: NP_990109
CGNC: 12932
Ensembl: ENSGALG00000017211
UniProt: Q9IAM7
Position
1
AA seq 700 aa
MSAVSLQDDEDTFKILIATDIHLGYLEKDAVRGNDTFVTFNEILEHAQKNEVDFILLGGD
LFHENKPSRKTIHTCLESLRKYCMGDRPVSFEVLSDQAVNFQLSKFPWVNYQDENLNIFM
PIFSIHGNHDDPTGVDALCALDILSCAGLLNHFGRSTSVEKIDISPILLRKGRTKIALYG
LGAIPDERLYRMFVNKQVTMLRPKEDEDSWFNMFVIHQNRSKHGATNYIPEQFLDDFINL
AVWGHEHECKITPAQNEQQHFYVTQPGSSVVTSLSPGEAVKKHIGLLRVKGKKMKMQRIA
LETVRTFYMEDVVLADHPELFNPDNPKVTQAIQAFCMEKVEMMLDNAERERLGNPRQPQK
PLIILRVDYTGGFEPFIVHRFSQKYMDRVANPKDIIHFFRHREQKEKNDNDINFGKLLSR
PASEEVTLRVEDLVKQYFQTAEKKVQLSLLTERRMGEAVQEFVDKEEKDAIEELVKFQLE
KTQRFLKERHIDAEEEKIDEEVRKFRESRRKNTEEEDEEVREAMTRARAHRSEGVVLDSA
SSDEGLMDTGMKASGDSDDDIPTTLSRGRGRGRARGARGQNSAARGSSRRGRGNTSQGSS
TSSRTYKSVPDKNSSIMDAFRSLKPEPSQSTSKFFSEDIIDDEMDLEESPISLSSKTNQR
SSAMSSFSKRGSQSQMSRGVDFESDEDDPFKNTATSRRKK
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgagtgccgtcagcttgcaggatgacgaagatacctttaagatactgattgctactgat
attcatcttggctatttggagaaggatgcagtgcgtggaaatgacacatttgtaactttt
aatgaaattttggagcatgctcaaaaaaatgaagtggactttattttattaggtggggac
ctctttcatgaaaacaaaccttccagaaaaacaatacatacatgtttagaatccctgaga
aaatactgcatgggtgatcgtcctgttagctttgaagttctgagtgatcaggcagttaat
tttcagctcagcaagtttccatgggtgaactatcaggatgaaaacctcaacatttttatg
ccaatttttagtattcatggcaatcatgatgatcccacaggggtagatgcactgtgtgca
ctggacattttaagctgtgcaggattgctgaatcattttggacgttcaacttctgtggag
aaaatagatattagccccattttattacggaagggtagaacaaaaattgctctgtacggc
ttaggggccattccagatgagaggttgtatcgtatgtttgtcaataaacaagtaaccatg
ctgagaccaaaggaggatgaagacagttggtttaacatgtttgtgattcatcagaataga
agcaaacatggagccacaaactacattccagagcagtttttagatgactttattaatctt
gctgtgtggggccatgaacacgaatgtaaaataactccagcccaaaacgaacagcaacat
ttctatgttactcagccaggaagttcagtggtgacgtctctgtcccctggagaagctgtg
aagaaacacattggtttgctgcgtgttaaaggaaaaaaaatgaaaatgcagaggattgct
ttagagactgtacgaactttctatatggaagatgttgtcctggctgatcacccagaactt
tttaatcctgacaatcctaaagtaactcaggcaatacaagcgttctgcatggaaaaggtt
gaaatgatgctggataatgcagaaagagaacgccttggaaatccgcgccagccacagaag
cctctcattatattacgagttgattacacaggtggctttgagccattcattgtccatcgt
ttcagccagaagtacatggatagggtggccaacccaaaggacatcatacattttttcaga
catcgtgaacaaaaagagaaaaacgacaatgatattaattttggaaagctgcttagcaga
cctgcttctgaggaggtgacactgagagtggaagaccttgtaaagcagtattttcagaca
gcagagaagaaagtacaactttcacttctaactgaaagaagaatgggagaagcagtgcag
gagtttgtggacaaagaagaaaaagatgccatagaggaactggtgaaatttcagctagag
aaaacacagagatttcttaaggagcgtcacattgatgcagaggaagaaaaaatagacgag
gaggtgcgaaagtttagggagagtagaagaaaaaacaccgaagaggaggatgaagaagtt
cgtgaggcaatgacgagggctagagctcacaggtctgaaggtgtagttcttgattcagcc
tccagtgatgaaggactcatggatactgggatgaaagcatcgggtgattcagatgatgac
attcccacaacactaagccgaggaaggggaagaggtagggcaagaggtgcaagagggcaa
aattcagcagcaagagggtcatctcgaaggggaagaggaaacactagccaagggtcatct
actagcagcagaacatacaagtctgtgcctgacaagaattcgtctatcatggatgccttt
aggtctttgaaaccagagccttcccagagtacatctaaatttttctctgaggatattata
gatgatgaaatggatctagaagagtctcctattagtctttcttccaaaacaaaccaaagg
tcctcagctatgtcttcatttagtaaaagaggttcacaaagccaaatgtccagaggagtt
gattttgagtcagatgaggatgacccgttcaaaaacactgcaacatcacgaaggaagaaa
tga

DBGET integrated database retrieval system