KEGG   Gallus gallus (chicken): 395559Help
Entry
395559            CDS       T01006                                 

Gene name
EPHA4
Definition
(RefSeq) ephrin type-A receptor 4 precursor
  KO
K05105  Eph receptor A4 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395559 (EPHA4)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     395559 (EPHA4)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   395559 (EPHA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_2 SAM_1 Pur_ac_phosph_N Ephrin_rec_like DUF2369 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 395559
NCBI-ProteinID: NP_990112
CGNC: 3911
Ensembl: ENSGALG00000005256
UniProt: Q07496
Position
9
AA seq 986 aa AA seqDB search
MAGVPVGALLPLLVGVCGAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWIPREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESNNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGYEERNGECQACKIGYYKALSTDVACAKCPPHSYSI
WEGSTSCTCDRGFFRAENDAASMPCTRPPSAPQNLISNVNETSVNLEWSAPQNKGGRDDI
SYNVVCKRCGAGEPSHCRSCGSGVHFSPQQNGLKTTKVSITDLLAHTNYTFEVWAVNGVS
KHNPSQDQAVSVTVTTNQAAPSPIALIQAKEITRHSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVKTASRNTDIKGLNPLTSYVFHVRARTAAGYGDFSGPFEFTTNTVPSPII
GDGTNPTVLLVSVAGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGSESSRPST
ALLDPSSPEFSAVVSVSDWLQAIKMERYKDNFTAAGYTTLEAVVHMNQDDLARIGITAIT
HQNKILSSVQAMRSQMQQMHGRMVPV
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atggccggggtccccgtcggcgcgctcctcccgctcctcgtcggcgtctgcggggccgtc
accggctcccgcgtgtaccccgccaacgaagtgaccctgctggactcccgctcggtgcag
ggggagctgggctggatcgcgagcccgctggaaggagggtgggaggaagtgagcataatg
gatgagaagaacactccgatccgcacctaccaagtttgcaatgtgatggagcccagtcag
aataattggttacgaactgattggattccccgcgagggggctcagagggtatatattgaa
atcaagttcacgctgagagactgcaacagcctgccaggtgtcatgggaacttgcaaagag
actttcaacctctattactatgaatcaaacaacgacaaggagcgttttattcgagagagc
cagtttgccaagattgacaccattgctgctgatgagagcttcacccaggtggacattggt
gacaggatcatgaagctgaatacagaggtgcgggacgtggggcctctcagcaagaaaggg
ttttacttggctttccaggacgtcggtgcctgcattgctttggtgtctgttcgtgtcttc
tataagaagtgcccactgacagttcgaaacctggcacagtttccagacaccattactggg
gctgatacatcctctctggtggaggttcgtggctcctgtgtcaacaactcggaagagaag
gacgtgccaaaaatgtactgcggggcagatggtgaatggctggtacccattggcaactgt
ctgtgcaatgctggctatgaagaacgcaatggtgaatgccaagcttgcaaaatcggatac
tacaaggcgctctcaacagatgttgcatgtgccaaatgcccgcctcacagctactccatc
tgggaaggctctacctcctgcacctgtgatcggggcttcttccgagcagaaaatgatgct
gcatccatgccctgcactcgccctccatccgcaccccagaacctgatttccaacgtcaac
gagacgtcagtgaacttggagtggagcgccccacagaacaagggaggacgggacgacatc
tcctacaacgtggtgtgcaagcgctgcggggcaggggagcccagccactgccggtcctgt
ggcagtggtgtacatttcagcccccagcagaacgggctgaaaaccacgaaggtttccatc
actgacctcctggcacacaccaactacacctttgaggtctgggcagtgaatggagtgtcc
aagcacaaccccagccaggaccaagctgtgtcagtcactgtgacaactaaccaagcagct
ccatccccaattgcattgatccaggctaaagagataacgaggcacagcgttgccttggcc
tggctggaacctgacaggcccaatggagtcatcctggagtatgaagtcaagtactatgaa
aaggaccaaaacgagcgcagctatcgcattgtgaagacagcctccaggaatactgacatc
aaaggtttgaaccccctgacttcatatgtatttcatgtgcgggccaggacagcagcagga
tacggagacttcagtgggccgtttgagttcacaactaacacagttccttcccccatcatt
ggcgatggtaccaatcccacagtgctgcttgtttcagtggctggcagtgttgttctcgtg
gtcattctcattgcagcctttgtcatcagcaggaggcgcagcaaatacagtaaagctaag
caagaggcagatgaggagaaacatttgaaccaaggtgtcagaacatatgtggatcctttt
acatatgaggatccaaatcaagctgtgagggaatttgccaaagaaattgatgcctcctgc
ataaagattgagaaagttattggtgtgggggaatttggtgaagtatgcagtggacgtctc
aaagttccaggaaaaagagaaatctgtgtggctatcaagactctgaaagctggttacact
gacaaacaacggagagacttcctgagtgaggccagcatcatgggacaatttgaccacccc
aatatcatccacttggaaggcgttgttactaaatgtaaaccagtaatgatcataactgag
tacatggagaatggctccttggatgccttcctccggaagaatgatggcagatttacagta
atccagttggtggggatgcttcgtggcatcggctcaggaatgaagtatctgtctgacatg
agctatgtgcatcgggatctagctgctcgaaacatactggtcaacagcaacttggtctgc
aaagtgtctgacttcggcatgtcccgtgtcctggaagatgaccctgaggcagcttatacc
acacggggtggcaagatccctatccgatggactgcaccagaggcaattgcctaccgtaaa
tttacatcggctagtgacgtgtggagctatggcatcgtcatgtgggaagtgatgtcctat
ggagagagaccttactgggatatgtccaatcaagacgttattaaagccattgaggaaggg
tatcggttgccacccccaatggactgccccattgctctccatcagctgatgttagactgc
tggcagaaggaacgcagcgacagacctaaatttggacagattgtcaacatgctggacaaa
ctcatccgcaaccctaacagcctgaagaggacaggcagcgagagctccagacccagcaca
gccctgctggatcccagctccccggagttctcggcggttgtttctgtcagtgactggctc
caagccattaaaatggagcgatacaaggataacttcacagctgctggctataccacccta
gaggctgtggtgcatatgaaccaggacgacctggccaggatcgggatcactgccatcaca
caccagaacaagatcttgagcagcgttcaagccatgcgcagccaaatgcaacagatgcac
ggcaggatggtgcccgtctga

DBGET integrated database retrieval system