KEGG   Gallus gallus (chicken): 395561
Entry
395561            CDS       T01006                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4 precursor
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    395561 (WNT4)
   04150 mTOR signaling pathway
    395561 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    395561 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395561 (WNT4)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Morphogens
   395561 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 395561
NCBI-ProteinID: NP_990114
CGNC: 3556
Ensembl: ENSGALG00000041708
UniProt: P49337
Position
21
AA seq 351 aa
MSPEYFLRSLLLIILATFSANASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDTLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELDKCGCDRTVQGGSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SNRALMNLHNNEAGRKAILNNMRVECKCHGVSGSCEFKTCWKAMPPFRKVGNVLKEKFDG
ATEVEQSEIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTSGRQCNKTS
KAIDGCELMCCGRGFHTDEVEVVERCSCKFHWCCSVKCKPCHRVVEIHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagcccggagtatttcctgcgctccttgctgctcatcatcctcgccaccttctcggcc
aacgccagcaactggctgtacctggcgaagctgtcttcggtggggagcatctctgaggag
gagacctgcgagaagctgaagggcttgatccagcgccaggtgcagatgtgcaaacggaac
ctggaggtgatggactcggtgcggcgcggggcccagttggccatcgaggagtgccagtac
caattccgcaaccgccgctggaactgctccacgctggacaccctgcctgtctttggcaag
gtggtaacacaagggacgcgggaggcagcgttcgtctacgccatctcttcagcaggggtg
gccttcgccgtgacccgagcgtgcagcagcggcgagctggacaagtgtggatgcgaccgc
acggtgcaaggcggcagcccgcagggcttccagtggtctggctgctccgataacattgcc
tatggcgtggccttctcacagtcctttgtcgacgtccgggagaggagcaaaggggcatct
tccaacagagcgctgatgaacctccataacaatgaggcggggcggaaggcgatcctgaac
aacatgcgggtggagtgcaagtgtcacggcgtgtcaggctcgtgcgagttcaagacgtgc
tggaaagccatgccccccttccgcaaagtgggcaacgtgctgaaggagaaattcgacggc
gccactgaggtcgagcagagcgagatcggctccaccaaagtgctggtgccgaaaaactcc
cagttcaaaccgcacacggacgaggatctcgtctacctggactccagtcctgacttctgt
gaccacgacctcaagaacggggtgctgggcaccagcggccggcagtgcaacaagacctcc
aaggccatcgatggctgcgagctcatgtgctgcggtcggggcttccatacggacgaagtg
gaggtggtggaaaggtgcagctgcaaattccactggtgctgctctgtcaagtgcaaaccc
tgccatcgggtggtggaaatccacacgtgccggtga

DBGET integrated database retrieval system