KEGG   Gallus gallus (chicken): 395565
Entry
395565            CDS       T01006                                 

Gene name
VCAN
Definition
(RefSeq) versican core protein precursor
  KO
K06793  versican core protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    395565 (VCAN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:gga00535]
    395565 (VCAN)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395565 (VCAN)
   04091 Lectins [BR:gga04091]
    395565 (VCAN)
Proteoglycans [BR:gga00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   395565 (VCAN)
Glycosaminoglycan binding proteins [BR:gga00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   395565 (VCAN)
Lectins [BR:gga04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   395565 (VCAN)
SSDB
Motif
Pfam: Xlink Lectin_C V-set EGF Sushi hEGF Ig_3 ig I-set
Other DBs
NCBI-GeneID: 395565
NCBI-ProteinID: NP_990118
CGNC: 49376
Ensembl: ENSGALG00000015624
UniProt: Q90953
Position
Z
AA seq 3562 aa
MLLNIKSIIWMCSTLAITYMLPKVKAEKKTLVKGSLSGTSVLPCFFSTTPTIASSYAAEY
LRIKWSKVELDKSGKDAKETTVLVAQNGNIKIGQNYKDRVSVPTHSEETGDASLTFSRLR
ASDAGVYRCDVMYGVEDTQGIVSLAVDGVVFHYRAATSRYTLNFTQAQQTCLDNGAVIAS
PEQLKAAYEDGFEQCDAGWLSDQTVRYPIRHPRIGCFGDKMGKKGVRTYGRRFPNETYDV
YCYVEHMQDEVVHVSVPEKLTFEEAKELCRKRDGVLASVGNMYVAWRNGFDQCDYGWLAD
GSVRYPASVARPQCGGGLLGVRTLYRYENQTGFPYPDSKFDAYCYERKKIVSEPTTVKLV
TTLKTDSVELSSAKVTLKPSVFESSVTEVAVTKTKVPAWEEATLETEDTKMTTEVAEEKR
EMEVLMENIKLTTLLPQTVTDGEISPYDTLGRTEYDVSPRLTESTSAALEVEHTYSEAEL
SEEQGRSESTEDAFLTSVVFQDSTAVAKSSTGSWEDIETGDTQKHDGDNQTEQIEVGPVM
TATDSLVPASQRELPRTGSSVSLTKENLYLGSHSTKEPTKKSMEAKSDKKLTTVVIPKAL
FTDQYDLTTGGEGRESMYTVMPDRVSGVALVSIPESDVPAVSETLMDELAVTTGQSSTAD
ESTPFIKFSSSATELDNEASAEGSREDLKDVHLTTSSGIPVSFTLFTANETGSEVTALSE
STSAPQKFEEGITSVLHSSQQTEGSAILEKQEKTKEPEMSTIDAKVLYITTVVPASVTAG
SEGRFGSEKFTHTPPVSGMWLQTDKDQVYMTEETSHTKRIELDTEDDISGMEPTSSPGQI
IEYTKHLGAPVSAVTDETKTSMETAETESDEEVVSADFDQTKGTTEVFHTSSSLDLEKFT
LSKIPEDESSATVKSFSSSSGTVLPTAVATVLEVTDHEADETSGYVLNMTFSTPEGEQRK
ATEKSPATSAEDEVSTGTEISKYTMTEGGQISSVTSAEKESVAALQEREEQPSVGLPETK
EPFKFTDVTEIETTVPQREGDTSLVPVTVGSEDIGEMQVTDHTSFDSIIHTEATVTSTKA
SEVFPKELSTKDQDRELGTAMGSTLPVTSVQMHEQKTTAGFESPQTTTQEKHDEMGSAYD
EMYPATELSVPALMLTEYGQVSGPVETSTRSLHLTGTPKAETATDQEEKITEAVPVTFGT
QAKVYESKGTTTREEDRDVGSWNSVLPPHTMLSSPSTAGSISLLTLGASPSQTPEGSGIS
EELEEVKTVPFSSRATDKTTVISDLTTSSISAVDKIQPTSASKPFVSSKSPRIIPEEDEE
VTSSDIIVIDESISPSKASAEDDLTGKMVEPEIDKEYFTSSTATAVARPTAPPTVMEATE
ALQPQEVSPTSHPDSGTDIRLYVIQITGNDTDHPVNEFLDLFSRHILPHAVDETHTDAES
AQTEPCTSDSVQDSSEYIILDPFFPNFMDFEEEEEDCENTTDVTTPPALQFINGKQQVTS
APKSTKAEEARSDQIESVAHSKNVTFSQINETNTFIISETEASGTMQPSKAGEVMGAFEV
TQPTADVAMLEPVYSGESEVTTTDKYLEITSVYEQSPKKNKETVMWHGTEESSTKDTKNL
LLITNESSGDGSTESDLSRSVFTEILTMSSHEDSEKISHTTSVPTILSVERSAVTAAPSA
DSDTATVGIDVKDLIPKGGTATPGNYYKSTIKLDAEFPFESNPEATSHTTKPDMTASSFI
VLEGSGDVEENSTLASAMTTETAVAETLSVQDTSLGSGTVLPTEISVTISEITPALPGGT
RILYSTFDQSSEATVSTNFVSELIMEQVVGSSVATEKKVEDEKEVQTTVYSSQEISTTDA
KGKSELDEFGSTTNEVRTVSQEPTPLREIVPITGTMHSEIKKVTATPFLREKLFINEGSA
EEPADLFAGSPTRKVVSTDSPFTDSGSGDIDVITESATLTSVPSRSVIETQTVKHEGNIN
VISVSLKNTTTEYEEHIGTGGPVTSVSSTGSDGLTEESEVAIEMSENVFSTENQGEPTQE
AVPTYTAPSDIKSRLGSRREVTSHVTPVIRTKDLETAEVTSSPESVVNNSTLDTMVTHGT
IRAVAESTESKKGKGSFSAVSLGKILMIEHGSGEELKVDSSTTKLMSNGPTEKLLGSHFS
FFDQGSGEAETLTESFTKASVSPTGKPEPQEQYGRKTVSMPSAVVHAYTAEPNELVTSTE
HDITSLQTVTDTEMEEKAANELTVTSFATNLPLSEDVHSWEDRPREILPKAIESSGEATE
DPFFISTQANHEHVEFLSVPTIRPHSEENKVEAESDEKILLPFNNDRVTESAVIERKYLS
SPFTDTEQEEELVQNIFPTEDIPRLFLTPKEEKPTNNELISDPLFSGQGSGDEFTVIPSV
ESLAVKETTNTLSPWPFHPASVGPKLSTDKTQVFESGSTDSNAEINEEITTTAAELTETA
YSMATSSPALEEESSSHSNSKDKDITHYFLVIEDPYNKEMDHRRGENGTSRPLPTPGDVS
LEESSHMLTTDDVTPVSVILSETPYLEMGKSLATSATKMPSRVLPESSGEGSGWDGVSDS
FAPDTLTHSTAPSVMEVELTASSHIPGVYSEVMTTHVPGDGSQTVITGLASLFTEEKEIV
ANRTAADPKTGTSEELTSDTGMSLDIIPVVDDRRHVTLNVSVYGDITLIEERLQIPSEKT
TIIDMDHSKSMPEDIISVQTMPNLVIRSTQVSDDNMKAEEDKYDSILNFSTVEENSFGSG
DNLSLTTSIQPSSESVTAGHGPKLVDKDLGSGYAMQFATETLTTTVLNELGIFLPTVPSL
VSPHMPHESKESEFEAKHIGRTSTTDDVYEPYTSANNQVITDQSKTMSISGFSGMGQEES
GDKKPMIPSLTPDLTMETEKALTTDTFDVSMVTTQSMSQHATVSSSSSEEKHSTVYMQTK
SASTEYEETDSVSLNSVSQNPKSSVTVWLVNGVSKYPEVIIPSTSSAKDSDQSDHSSDGT
FKEVSSDMAATYKPPTTDLDTTVSSLLVFSPEPESESISTESTPHFNKFVTERSEETESS
VNDLIIEENATVSGDSPSIHDYPTAFWNFGERTSTDVPKLSTIEVEFSSERVKNPSQESD
RSTERERPRLSSAPVSDSPNSIEVGVFKPDQEAVTMLTSSLEPLDRSLETQSALLGPLLG
QQEITTISSNIATNNTAPGNNPYSNEQSTISSELLNTIELVTSSFSLPEVTNGSDFLIGT
SVGSVEGTAVQIPGQDPCKSNPCLNGGTCYPRGSFYICTCLPGFNGEQCELDIDECQSNP
CRNGATCIDGLNTFTCLCLPSYIGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDTAER
ECRLQGAHLTSILSHEEQVFVNRIGHDYQWIGLNDKMFERDFRWTDGSPLQYENWRPNQP
DSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRY
EINSLIRYHCKDGFIQRHIPTIRCQGNGRWDMPKITCMNPSTYQRTYSKKYYYKHSSSGK
GTSLNSSKHYHRWIRTWQDSRR
NT seq 10689 nt   +upstreamnt  +downstreamnt
atgttgttaaacataaaaagcatcatatggatgtgctctacgttagctataacatatatg
ctacctaaagttaaagcagaaaaaaaaaccctggtgaagggatccctctctggaacgtca
gtccttccatgcttcttttcaaccacacccaccatagcctccagctatgcagccgaatat
cttcgaatcaaatggtcaaaggttgaactggataaaagcggaaaagatgcaaaagaaacc
acagtccttgtggcccagaatgggaacatcaaaataggccagaactacaaggacagggtg
tctgttccaacccattcagaggagaccggtgatgcttcactgactttctctaggctgcgt
gcaagtgatgcaggggtgtaccgctgtgatgtgatgtatggagttgaggacacacaaggc
attgtatcgctggctgttgatggtgtagtatttcactatcgtgcagccaccagcaggtac
actttgaattttacacaagctcagcagacttgtttggacaatggtgctgtcatagcaagc
ccagagcaactgaaggcagcatatgaagatggatttgaacaatgtgatgctggctggttg
tctgaccagactgttaggtatccaattagacatccaagaattggttgctttggagataaa
atgggaaagaaaggagtcagaacatatggacgccgttttcctaatgaaacttatgatgtg
tattgctatgtggaacacatgcaagatgaagttgttcatgtttctgttcctgagaagctc
acctttgaggaagcaaaagagctatgtcggaaaagagatggtgttcttgcttctgttgga
aacatgtatgtggcctggaggaatggatttgaccaatgtgactacggctggctggcggat
ggaagtgttcgttaccctgcctctgtggcaaggccccagtgtggtggaggtttacttggg
gtgagaaccctgtatcgctatgagaaccaaacaggctttccttacccagatagcaagttt
gatgcctactgctacgaacgtaaaaaaattgtatcagagcctacaactgttaagctggtt
acaactctgaaaactgacagtgtggaactatcatctgctaaagttactcttaaaccttct
gtttttgagagttcagttactgaagtggctgtcaccaaaacaaaggtccctgcttgggag
gaagcaaccctagagactgaagatacaaaaatgactactgaagtggctgaggagaaaagg
gaaatggaggtgcttatggagaacattaagttaaccacccttttacctcagactgtcaca
gatggtgaaataagcccttatgatacgctgggaaggactgaatatgatgtttcacctagg
ttaacagagagcacatctgcagctttggaagtggagcacacttactctgaagcagaattg
tccgaggaacaaggtaggtctgaaagcactgaggacgctttcttgacctctgtagttttt
caggatagcacagctgtagctaagagttccactggttcatgggaagatattgaaacagga
gatacacaaaaacatgatggtgataatcagactgaacaaatagaagtgggtcctgtgatg
acagctacagatagcttggtaccagcttctcagagagagttgcccaggacagggtcttca
gtttcactaacaaaagaaaatctgtatcttggttctcactcaacaaaagaacccacaaaa
aaatcaatggaagcaaaatctgacaagaaacttacaactgttgtaatccctaaggctttg
ttcactgatcagtatgatcttactacagggggggagggaagagagagcatgtacaccgtt
atgcctgatagagtttctggcgtggctctggttagcatcccagaatcagatgttcctgct
gtatcagagacactcatggatgagcttgcggtaaccactggacaatcttctacagcagat
gagtcaactccattcattaaatttagttcttctgcaactgagttggataatgaggcgtca
gctgagggaagcagagaggacttaaaagatgtgcatctcaccacgtcatctggaatacct
gtatcctttactttattcaccgccaatgagacaggatctgaggtcactgctctctcagaa
agtaccagtgccccacagaagtttgaagaaggcatcacatctgttcttcactcatcgcag
caaacagaaggatcggctattttagaaaagcaggaaaaaacaaaggagccagaaatgagt
acaatagatgctaaagtcctttatatcacaactgttgttcctgcttctgttacggcagga
tctgagggacgctttggaagtgagaagttcacgcacactcctccagtttctggcatgtgg
ctgcagacagataaggatcaggtctacatgacagaagaaacatctcatactaagagaatt
gagttagacactgaagatgatatctctggaatggagcctacatcatctccagggcaaatt
atagaatatacaaagcatctaggagctccagtttcagcagtaacagatgaaaccaagaca
agcatggagacagcagaaacagaaagtgatgaagaagtagtatcagctgattttgatcag
actaaaggtactacagaggtcttccatacaagcagctctttagatttggaaaagtttact
ctatccaaaataccagaggatgaaagtagtgcaacagtgaaatcgtttagctcctcaagt
ggtactgtgttaccaactgctgtggccactgtcttggaggtgactgatcatgaagcagat
gaaacatcaggatatgttttgaacatgaccttttctaccccagaaggtgaacaaagaaag
gctactgagaaatcacctgcaacttctgctgaagatgaagtctctacaggaacagagatc
tcaaaatacacaatgacagaaggcggccagataagcagtgtgacatctgctgagaaggag
tcagtggcagcacttcaggagagggaagaacaaccgtctgttggcttaccagaaacaaag
gaaccctttaagtttacagatgtaacagagatagagactacagttccacagagagaaggt
gatacttccctagttccagtcactgtaggtagtgaggacattggagagatgcaagttact
gaccatacttcttttgacagtatcattcatactgaagcaacagtaacaagtacaaaagct
agtgaagtgtttcctaaggagctctccacaaaagatcaagatagggaactaggtactgcc
atggggtctaccttacctgtgacatctgtccaaatgcatgaacaaaagacgacagcagga
tttgaatcacctcaaacaaccactcaggaaaaacatgacgagatgggttcagcctatgat
gagatgtatccagcaacagaattatcagtgcctgcattaatgcttacagaatatggacaa
gtttcagggcctgttgaaactagcaccaggtctttgcatctcacagggactcccaaagct
gagactgctactgaccaagaagagaagattacagaagcagtgcctgtaacatttggtaca
caagcaaaagtgtatgaaagcaaaggaaccaccacaagggaagaagacagagatgtagga
agctggaattctgtgttgcccccccatacgatgctgagtagtccttctactgcaggaagt
attagtcttctgactttgggagcttctccaagtcaaactccagaaggttcaggaatatca
gaagagcttgaagaagtcaaaacagttccattttcatctagggcaacagataagacaact
gttattagtgatttaactacatcatctattagcgctgtagacaaaattcagcctacatca
gcatccaaaccttttgtttcttcaaagtcgccacgtattattcctgaggaagatgaggag
gtaacaagcagtgacatcatagtaattgatgaatctatttctccaagtaaagccagtgct
gaagatgatctgacaggaaagatggtagaaccagaaattgataaggaatatttcacatca
tcaactgctactgcagttgcacggcctactgcaccacccacagtgatggaggccacagag
gccttacaaccacaagaggtgtctcctacttcacaccctgacagtggaactgacataaga
ttgtatgttattcaaatcacaggcaatgatacagatcatccggtgaatgagtttttggat
ctgttcagtcgccacattcttcctcatgcagtagatgagacccatactgatgcagaatca
gctcagactgaaccctgtacttcagactctgtgcaggattcgtctgaatatataatattg
gatcctttctttccaaactttatggactttgaagaggaggaagaggactgtgaaaatact
actgatgttacaactcctccagctttgcagttcatcaatggaaagcaacaagtgacaagt
gcacctaaaagcactaaagctgaggaagcaagaagtgaccaaattgaaagtgttgcacat
tcaaaaaatgtaactttttcacaaatcaatgaaacaaacaccttcataatatctgaaaca
gaagcttctggtacaatgcagccaagcaaagctggagaagtaatgggggcatttgaagtc
acacagccgacagcagatgttgcaatgttagaaccagtatatagtggtgagtcagaagtt
accacaacagacaaatatttagagattacgtctgtgtatgagcagtcaccaaaaaaaaat
aaggagactgtaatgtggcatggaactgaggagagctctaccaaagacacaaaaaacttg
cttttgatcactaatgaatcttctggagatggctccactgaatctgatttgtctaggtct
gtgttcacagaaattttgacaatgtcaagtcatgaagatagtgaaaaaatttctcataca
acttctgttcctactatcctttctgtggaaagatctgcagtaactgctgctccgagtgca
gattctgatactgctactgtaggcatagatgtgaaagaccttattccaaaaggtgggacc
gctactccaggaaattactataaatcgactattaaacttgatgcagaattcccttttgaa
agcaacccagaagcaacaagtcatacaacaaagcctgacatgactgcttcttcttttata
gttctggaaggttctggagatgtagaagagaacagcactttagcttcagccatgacaaca
gaaacagcagttgcagaaacactttcagtgcaagatacttctttgggttctggcacagta
ctgccaacagaaatttctgtaaccatttcagaaatcacccctgctttgcctggaggaaca
agaattctttattctacttttgatcaaagttctgaagcaactgtttccaccaattttgtg
tctgaattaattatggagcaagtagttggcagctctgttgcaactgaaaagaaagttgaa
gatgaaaaagaagtacagactaccgtttattcgagtcaggaaatttcaaccactgatgca
aaaggaaaatcagaactggatgagtttggaagcactactaatgaagtcagaactgtaagt
caggaacccactcctctcagagaaatagtaccaataacaggtaccatgcattctgaaatc
aaaaaggttaccgccactcctttcttgagagagaagctttttataaatgaaggatcagct
gaagaaccagcagacttatttgcagggagtcccacaagaaaagtggtaagtactgactcc
ccatttactgattcaggttctggagacatagatgttatcactgagtctgctactttgact
tcagttccatcaaggtctgtcatagaaacacaaacagtaaaacatgaaggaaatattaat
gtcatcagtgtttcattgaagaataccacaacagaatatgaagagcacataggaacaggt
ggaccagtgacatcagtttcaagtactggatcagacggcttgacagaggagtctgaagta
gcaattgagatgtctgagaatgtctttagtacagaaaaccaaggagaaccaacacaagaa
gcagtaccaacttacacagctccttctgacatcaaatcaagacttggttctagaagagag
gtaacatcccatgttacaccagtaattagaacaaaggatttagaaacagctgaggtcaca
tcatctccagaatcagttgtgaataacagcactcttgacaccatggtgacacatggtacc
ataagagcagtagctgagtctacagaaagcaaaaagggaaaaggtagcttttcagctgtt
tctttgggcaaaattctaatgattgagcatggctctggagaagaactcaaagttgacagc
agcaccacaaaattaatgtctaatggacctacggaaaaactgcttggaagccatttttca
ttttttgaccagggatctggtgaagcagaaactttaactgaatcatttacaaaagcatca
gtttcacccactgggaaaccagaaccacaggagcagtatggcagaaaaactgtcagcatg
ccatccgctgtggttcatgcctacactgctgaacctaatgagctagttacaagtactgaa
catgacataacctctttgcaaactgtaactgatacagaaatggaagagaaagcagctaat
gagctcacagtgacatcttttgctacaaatcttcctttgtcagaagatgtgcattcatgg
gaagacaggccaagggaaattttaccaaaagcaatagaatcttctggagaagcaacggaa
gatccattcttcataagtacacaggctaaccatgaacatgtggaatttttaagtgttccc
actatcagaccacactcagaagaaaacaaagtagaagctgaatctgatgaaaaaatattg
ttgccatttaataatgacagagttactgagtctgcagtaattgaaaggaaatacttaagt
tctccatttacagatacagagcaggaggaggagttggtacaaaatatttttcctacagaa
gatattcccagattattcctgacacctaaggaagaaaaaccaacaaacaatgagctcatc
agtgatccattattttcaggacaaggatcaggagatgaatttactgttattccttcagta
gagtcattggctgtgaaagaaaccacaaatactttaagtccttggccttttcatcctgca
agtgtaggacctaaactttccactgacaagacacaagtctttgaaagtggaagcactgac
tcaaatgctgaaattaatgaagaaattacaactactgcagcagagctgacagaaactgca
tactcaatggccaccagttccccagctttagaagaagagagctccagtcactccaactct
aaagacaaagatattacacattattttcttgtgattgaagacccgtacaacaaggaaatg
gaccatagaaggggagaaaatggaacgagcaggccactacctactcctggagatgtttct
cttgaggaatcttcacatatgctgactacagatgacgtaactcctgtttctgtaatactg
agcgaaactccttatcttgaaatgggaaaatctcttgcaacatcagcaacaaaaatgcca
agcagagtattacctgaaagttctggagagggatctggttgggatggtgtttcagattca
tttgcccctgatacattgactcattcaacagcaccttctgtgatggaagttgaactaact
gcttcatctcatattcctggggtttattctgaagttatgacaacacatgtaccgggagat
ggatcacagactgtaatcacaggattagcatctctttttacagaagaaaaagagattgtg
gcaaatcgaactgctgctgatccaaagacaggtacatcggaagaactgacgagtgatact
gggatgtcactggatattattccagtggttgatgatagaagacacgttacactgaatgtt
tctgtttatggtgatattacactaattgaagaacgacttcaaatcccatcagaaaaaaca
actattatagacatggatcactccaagtcaatgcctgaagatataataagtgtgcagaca
atgccaaatcttgtcatacggtcaacacaagtcagtgatgataacatgaaagctgaagag
gacaagtatgattcaatacttaatttttctacagttgaagagaattcatttggatctggt
gataatctttctttgactacttccattcagccaagtagtgaatcagtaacagctggacat
ggaccaaaattagtagacaaggatttaggttcagggtatgccatgcagtttgcaacagaa
actctcacaactactgtactcaatgaattgggaattttccttccaacagtaccctcactg
gtaagcccacatatgcctcatgagtctaaagaatctgagttcgaggctaaacacattgga
aggacaagcacaacagatgatgtgtatgagccttatacttcagcaaacaaccaagtaata
acagatcaaagcaaaacaatgtctatttctggattttctggaatgggccaagaagaatca
ggtgataaaaagcctatgattccttcccttacaccagatttaactatggagacagaaaag
gctttgacaactgacacatttgatgtaagtatggtcaccacgcagagtatgtcccaacat
gcaactgtatcatctagcagtagtgaagaaaagcattctacagtatacatgcaaacaaaa
tcagcatcaacagagtatgaagaaacagactcagtgagtttaaattctgtatctcaaaat
cctaaatcctcagtaactgtttggttagttaatggagtatctaaatatcctgaggtaatt
attccaagtacatcatctgcaaaggattcagatcagtctgatcattcctcagatggaact
ttcaaagaggttagttctgatatggcagcaacttataaaccacccactacagacctagat
acaacagtgtcttctctgctagtgttttctcctgagcctgaatcagaaagcatatctact
gaaagtactcctcactttaataaatttgtaacggagaggtcagaggagacagaatcttct
gtaaatgatctgattattgaggaaaatgctactgtttctggagattctccatcaatacat
gactaccctactgctttttggaattttggagaaagaacaagcacagatgttccaaaactt
agcacaatagaagttgaattttcttcagagagagtgaaaaatcccagtcaagaaagtgat
aggagtactgagagagagagaccaaggctttcatccgcacctgtttcagattcacccaac
agtatagaagttggagtatttaaacctgaccaggaagcagttacaatgctaacttcatct
ttggagcctttggatagaagtttggaaacacagtcagctttgcttggtcctttgcttggt
caacaggagatcacaacaatttcttctaacattgcaacaaacaatacagcccctggaaac
aatccttattcaaatgaacagtcaacaataagctctgagttgctaaatactattgaactt
gtaacttcatcattttcccttccggaagtcactaatggatcagatttcctgattggcaca
agtgtgggttcggttgaaggcacagcagtgcaaattccaggacaggatccatgcaaaagt
aatccctgccttaatggtggtacctgctatccacgtggttcattttacatctgtacatgt
ttgccaggtttcaatggtgagcagtgtgaattagatattgatgaatgccagtctaaccca
tgccgcaatggagccacatgtatagatggcctcaatacatttacttgcctgtgtctacca
agctatattggtgctctctgtgagcaagacacagagacttgtgattatggttggcacaag
ttccaaggacagtgctacaaatactttgcccaccgacgtacctgggatacggctgagaga
gaatgccgcctacaaggagcccacctgacaagcattttatcccatgaggaacaagtcttc
gtgaaccgtattgggcacgactaccagtggattggcctcaatgacaagatgtttgagcgt
gatttccgctggactgatggtagcccactgcaatatgagaactggcgaccaaaccagccg
gatagtttcttttctgctggagaagactgtgttgttataatatggcatgagaatgggcag
tggaatgatgttccatgcaattaccacctgacctacacctgcaagaaaggaacagttgcc
tgtggtcaacctcctgttgtagaaaatgcaaagacctttgggaagatgaaacctcgttat
gagattaattcccttattagatatcactgcaaagatggtttcatccaacgtcatattcca
accatacgttgccaagggaatggaagatgggatatgcctaaaattacatgcatgaatccg
tccacataccaaaggacttattctaagaaatactactataaacattcttcatcaggaaag
ggaacatcattaaattcctcaaaacactaccatcgctggatcaggacgtggcaggactca
aggcgctga

DBGET integrated database retrieval system