KEGG   Gallus gallus (chicken): 395568
Entry
395568            CDS       T01006                                 

Gene name
COL5A1
Definition
(RefSeq) collagen alpha-1(V) chain precursor
  KO
K19721  collagen type V/XI/XXIV/XXVII, alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395568 (COL5A1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   395568 (COL5A1)
SSDB
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Other DBs
NCBI-GeneID: 395568
NCBI-ProteinID: NP_990121
CGNC: 49379
Ensembl: ENSGALG00000002546
UniProt: Q9IAU4 A0A1D5PE74 Q90689
Position
17
AA seq 1835 aa
MDTHTRWKRRSWIRNWQLHVALVLLGAAALGRAAEPADLLKVLDFHNLPDGITRTTGFCT
SRRSSKEADVAYRVTKDAQLSAPTKQLYPASPFPEDFSILTTVKAKKGGQSFLISIYNEQ
GIQQIGVEMGRSPVFLYEDHTGKPGPEDYPLFRGINLADGKWHRVAISVQKKNVTLILDC
KKKITKFLDRSDHPIIDVNGIIVFGTRILDEEVFEGDIQQLLIVADPRAAHDYCEHYSPD
CDTAVPDAPQSQDPNQDEYYTDGEGEGDTYYYEYPYYEDVDEAVKPEAPTTKPAPPGVAA
GERPETKQDYPSPTPSPEAGNPSRQTKGAAPVDDPLVDEYNYETINEEYFTPLPYEDINY
NEEVDPQGGLTENAVEAELPTSTVITYNETDAAQGGDDLDKDFTEETIKEYDGNYYYYDR
TVSPDIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLVEGPPGPEGPAGLPGPPG
PTGPVGLMGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFSGGGDAGSKGPMVSAQEA
QAQAILQQARLALRGPAGPMGLTGRPGPMGPPGSGGLKGEAGEMGPQGPRGIQGPPGPAG
KPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGNRGEPGPHGPPGAPGEDGERG
DDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVAGMDGQTGPKGNVGPQGEPGPPGQQG
NPGAQGLPGPQGPIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGSQGPPGPQG
PIGYPGPRGVKGADGVRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGEDGPEG
PKGRSGPNGDPGPLGPAGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGTRGTPG
KPGPRGQRGPTGPRGERGPRGSTGKPGPKGNSGGDGPPGPPGERGPPGPQGPTGFPGPKG
PPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPPGPPG
EQGLPGLTGKEGTKGDPGPAGLPGKDGPPGLRGFPGERGLPGPIGSPGLKGNEGPPGPPG
PAGSPGERGPAGSAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGIQGPVGLPG
PAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPAGADGEPGPRG
QQGLFGQKGDEGPRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPSGPPG
ADGPQGPAGGIGNPGAVGEKGEPGESGEPGLPGEVGLPGPKGERGEKGEAGPSGAAGPPG
PKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPTGEPG
PSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLRGIPG
PVGEQGLPGSPGPDGPPGPLGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQGEKGDRG
LPGPQGSAGPKGEQGITGPSGPIGPPGPPGLPGPPGPKGAKGSSGPTGPKGESGLPGPPG
PPGPPGEVIQPLPIQSSKRTRRNIDASQLVDDGNADNYMDYADGMEEIFGSLNSLKLEIE
QMKHPLGTQHNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGETCIFP
DKKSEGARITSWPKENPGSWFSEFKRGKLLSYVDSDGNPIGVVQMTFLRLLSASAHQNIT
YNCYQSVAWHDATTDSYDKAIRFLGSNDEEMSYDNNPYIRAAFDGCAAKKGYQKTVLEIN
TPKVEQVPIVDIMFNDFGEASQKFGFEVGPACFMG
NT seq 5508 nt   +upstreamnt  +downstreamnt
atggatacgcacacgcgatggaaaaggcgcagttggatacggaactggcagctgcacgtc
gcgctggtgctgctgggcgccgcggccctgggccgggcagctgaacctgcagacctcttg
aaggtattagattttcacaatttacctgatggtatcacaagaacaacagggttttgcaca
agcagaagatcttcaaaagaagcagacgttgcttacagagtaacaaaagatgctcagctc
agcgccccgacaaagcagctgtatcctgcttccccattcccagaggacttctccatttta
accactgtaaaagcgaagaaaggaggtcagtccttcttgatctcaatttacaatgagcaa
gggatccagcaaattggtgtggagatgggtagatctcctgtattcctgtatgaagaccat
acaggaaagccaggcccagaagactatcctctctttagaggcattaacctagcagatggc
aagtggcacagggtcgccatcagcgtgcagaagaaaaacgtcaccttgattttggactgt
aaaaagaaaataaccaagttcttggatcgaagcgaccatcccatcattgacgtcaatggc
atcatcgtatttggaacgaggatattagatgaggaagtctttgagggcgacatccagcag
ctgctgatcgtggccgacccccgggcagcccacgactactgtgagcactacagccccgac
tgtgacaccgccgtccccgatgctccacaatcccaggaccccaaccaggatgaatactat
accgatggggagggagaaggggacacctactactatgagtacccctactatgaagacgtt
gatgaagctgtaaagcctgaagcacccaccaccaaacctgcacccccaggagtggctgct
ggagagagacccgaaaccaagcaggactatccttcccccacgccatcccctgaagcaggg
aaccccagcaggcagaccaaaggggctgcacccgtggacgaccccctggtggatgagtac
aactatgaaaccatcaacgaggagtacttcacacctctgccctatgaagacatcaactac
aacgaagaagtagacccccagggagggctcactgaaaatgcagtggaggcggagctcccc
acgagtaccgtcatcacctacaatgagactgatgctgctcaaggaggagacgacctggat
aaagacttcaccgaggaaacgataaaagaatacgatgggaactactactattatgacaga
acagtgtctcctgacatcgggcctgggatgcctgccaaccaggacaccatctacgaaggg
attggaggcccacggggtgagaaggggcagaagggcgagcctgccattattgagccgggt
atgcttgtggaaggcccccctggtcccgaaggccccgcaggccttccaggacctccagga
ccaaccggacctgtgggcttaatgggagatcctggagagagaggaccgcctggccgccca
ggtcttccaggagcagatggtttaccaggaccaccagggacaatgcttatgttgcctttc
cgcttcagtggaggaggagatgctggctccaaaggacccatggtctctgcccaggaagct
caagcccaggccatcctgcagcaggcgaggttggcactgagaggaccggcgggtccaatg
ggtctgaccgggcggcccggccccatgggacccccaggcagtggaggattgaagggcgaa
gctggagaaatgggacctcagggtccacgaggcatccagggccctcccggcccggcgggg
aagccaggccgcaggggacgagctggcagcgatggtgcccggggaatgccaggacagaca
ggaccaaagggtgaccgagggtttgatggcttggctggtttgcctggcgagaaggggaac
agaggtgagccaggtccccacggccccccgggggcacccggagaggacggggagaggggg
gatgatggagaagttggacccagagggctgcccggagaacctggcccccgaggactgctg
ggacccaaagggccaccaggcccaccggggccaccgggtgtggccggtatggatggacaa
actggtcccaaggggaacgtgggtccccagggtgagccgggacccccaggccagcagggc
aacccaggtgctcagggtcttccaggtccacaaggccccatcggtcccccaggagagaag
gggccgctgggcaaacctggtcttcctggcatgcctggtgcagatggtcctccgggtcat
cctggcaaggaaggtcctcctggagagaaggggagtcagggtccaccaggccctcagggt
cccattggttatccaggtccacgcggagtcaagggagcggatggtgttcgtgggttgaag
ggcaccaaaggtgaaaagggtgaagatggcttccctggcttcaaaggggatatgggcatc
aagggagaccggggtgaaatcggacctccgggccccaggggtgaggatggccctgaaggt
cccaaaggtcgctcgggtcccaacggagaccccggtcctctcggtcctgctggagagaag
ggaaaacttggcgtgccagggctgcccggctacccgggcaggcagggcccaaagggctcc
attggcttcccaggatttccaggcgccaacggcgagaagggcacacgggggacacctggc
aaaccaggtccaagggggcaacgcggtccaacgggtccacgaggggaaagaggccctagg
ggaagcactgggaaacctggcccaaagggcaactctggtggtgatggcccccctggtcct
cctggcgaacggggaccaccagggcctcaaggaccaaccggatttcctggaccaaaaggc
ccccctggtcctcctgggaaggatggattgcctggtcaccccggacagagaggagaaacc
ggtttccaaggcaagactggcccacctggcccccctggtgttgtaggccctcagggccca
actggtgaaactggtccaatgggtgagcgaggacatccaggtcctccgggtcctccgggt
gaacaaggtcttcctggcctcactgggaaggaagggaccaagggggaccccggtcctgct
ggcctcccagggaaggatggtcccccaggcttgcgaggcttccctggagaaagaggtctg
cctggccccattggttctccagggctgaaaggcaacgaaggtcccccaggcccccctggt
cctgcaggctctcctggtgagcgaggtcctgcgggctcagctggccccattggcttacca
gggcgacctggcccacagggacctccgggacctgcaggtgaaaagggagccccgggcgag
aagggtcctcaaggaccagcaggtcgggatggcatccaaggccccgtgggactcccgggt
ccagcaggtcctgttggcccccccggcgaggatggagacaagggcgagatcggggagcct
ggccagaagggcagcaagggtgacaaaggggagcagggtccaccaggtcctacaggccca
caaggtccgatcggtcagccaggtccagctggtgctgatggagagccgggtcccagaggg
cagcaaggcctctttggtcagaaaggtgatgaaggacctcgaggtttccccggtcccccc
ggccctgtgggcttgcagggcttgcctggacctcctggtgagaagggagaaacaggagat
gttgggcaaatgggtccaccaggtccacctgggcccagaggcccctccggcccaccagga
gcagacggaccccaaggccctgctgggggaataggaaatcctggtgcagtaggagagaag
ggtgagcctggtgaatctggtgagcctggtctgcctggagaggtcggcctgccgggtcca
aaaggtgaaagaggtgaaaagggtgaagcaggtccctctggtgccgctggtccacctggc
cctaaaggtccaccaggtgatgatggtcccaaaggcagccctggtccagttggtttccct
ggtgaccccggtcctcctggagagcctggtccagctggtcaagatggtccccctggtgac
aaaggtgacgacggcgaacctggtcagacagggtccccaggtcccacgggagagccaggc
ccctctggacccccaggaaaaaggggccctcctggtccagctggtcctgaaggaaggcaa
ggagagaaaggagccaagggtgaagctggtttggaagggcctcctgggaagacaggccca
atcggtccccagggtgctccggggaagcccggccctgatggcctccggggaattcctggt
ccagttggtgaacaaggccttccaggatcccctggcccagatggccccccaggcccattg
ggcccacctggtttgcctggcctcaaaggagactctggtcctaaaggagaaaagggtcat
ccaggtttaattggtcttattgggccgccgggtgagcagggagaaaagggtgaccgaggt
ctcccgggcccccagggctctgcaggacccaagggagagcagggtatcacaggtccctct
ggaccaattggacccccagggccaccaggattaccgggtccacctggtcccaaaggtgct
aaaggatcatcaggtccaacgggtccaaagggtgaatcgggtcttcctgggcctccaggg
cctcctggtcctcctggagaagtcatccagcctctgcccatccagtcttccaagaggacc
aggcgaaacatcgacgccagccagctggtggacgatggaaacgctgacaactacatggac
tatgcagatggcatggaggaaatcttcggctcactgaattccttgaaactggaaattgaa
caaatgaagcatccattgggcactcaacataacccagctcgtacctgcaaggatctccag
ctctgtcaccctgatttcccagatggtgaatactgggtggatcctaaccaaggatgttcc
agggactctttcaaagtgtactgtaatttcacagctggtggagagacttgcatcttccct
gataagaagtctgaaggagctagaattacttcttggccaaaggaaaacccaggctcctgg
ttcagtgaattcaagcgcggtaaactgctctcctatgtggattcggatgggaaccccatc
ggagtggtacagatgacgttcctcaggctgctgagtgcctcggcccaccagaacatcact
tacaactgctaccagtccgtagcctggcacgatgccaccactgacagctacgacaaggcc
atccgcttcctgggctccaacgacgaggagatgtcctacgacaacaacccctacatccga
gctgcattcgatggctgcgcggcaaagaagggctatcagaagactgtcctggaaatcaac
acgcccaaggtcgagcaagtgcctatcgtcgacatcatgttcaatgacttcggagaagca
tcacagaaatttggattcgaggtgggaccagcttgcttcatgggctaa

DBGET integrated database retrieval system