KEGG   Gallus gallus (chicken): 395569Help
Entry
395569            CDS       T01006                                 

Gene name
GDNF
Definition
(RefSeq) glial cell line-derived neurotrophic factor isoform X2
  KO
K05452  glial cell derived neurotrophic factor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    395569 (GDNF)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   395569 (GDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta M-inducer_phosp GOLGA2L5
Motif
Other DBs
NCBI-GeneID: 395569
NCBI-ProteinID: XP_004937255
CGNC: 2717
Ensembl: ENSGALG00000003716
Position
Z
AA seq 185 aa AA seqDB search
MKLWDVVAVCVVLLNTVSTSPLPAANMPEDYPDQFDEVVDFIQATIKRLRRSPDKQTPIF
SRRERNRQSAATNVENSSKKGRRNQKGKNRGCVLTEIHLNVTDLDLGYETKEELIFRYCS
GSCDAVETTYDKILKNLTRKKKLVNDKVRQACCRPTAFDDDLSFLDDNLVYHILKKHSAK
RCGCV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagttatgggatgttgtggctgtctgcgtggtgctgctcaacacggtctccacctca
cccctgcccgccgctaatatgccagaggattacccagatcagttcgatgaggtagtggac
tttattcaagccactattaagagactgaggagatctccagataaacagactccgattttt
tctaggcgggagaggaaccggcaaagtgcagccacaaacgtagagaattccagcaaaaag
ggaaggaggaaccaaaagggcaaaaatcggggatgtgtcttaacagaaatacatttaaat
gtgactgacttggatttgggatacgaaaccaaagaagagctcatcttccggtattgcagt
ggatcttgtgatgcagttgagaccacgtatgacaaaattttgaaaaacttaaccagaaag
aaaaaactagtcaatgacaaagtgaggcaagcttgctgcagacccacagcctttgacgat
gacctgtcctttttggatgataacctggtttaccacatactgaaaaaacattccgcaaaa
aggtgtggatgtgtctga

DBGET integrated database retrieval system