KEGG   Gallus gallus (chicken): 395574Help
Entry
395574            CDS       T01006                                 

Gene name
PAX2
Definition
(RefSeq) paired box protein Pax-2
  KO
K15608  paired box protein 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395574 (PAX2)
   04131 Membrane trafficking [BR:gga04131]
    395574 (PAX2)
   03036 Chromosome and associated proteins [BR:gga03036]
    395574 (PAX2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    395574 (PAX2)
Membrane trafficking [BR:gga04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    395574 (PAX2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    395574 (PAX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_32 HTH_23 Homeodomain HTH_28 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 395574
NCBI-ProteinID: NP_990124
CGNC: 4240
Ensembl: ENSGALG00000005689
UniProt: Q9PTX1
Position
6
AA seq 394 aa AA seqDB search
MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLA
EGICDNDTVPSVSSINRIIRTKVQQPFHPTPDGSGTGVAAPGHTIVPSTASPPVSSASND
PVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSSVDSLRKHLRGDTFTQQQLEA
LDRVFERPSYPDVFQTSEHIKSEQGNEYSLPALTPGLDEVKSSLSTSANPDLGTNVSGPQ
TYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTTYNEA
WRFSNPALLSSPYYYSATSRGSAPPTAAAAYDRH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcactgcaaggcagaccccttctcagcaatgcacccagggcacgggggtgtg
aaccagctcgggggggtgtttgtgaacggcaggcccctacctgacgtggtgagacaaagg
atagtggagctggctcaccagggggtgcgaccctgtgacatttccaggcagctgcgggtc
agccacggctgtgtcagcaagatcctgggcaggtactacgagacggggagcatcaagccc
ggcgtgatcggcggctccaagcccaaagtagcgacccccaaagtagtggataaaatcgcc
gagtacaagagacaaaaccccaccatgttcgcttgggagattcgggacaggctactggcc
gagggcatctgcgacaacgacacggtccccagcgtctcctccataaacaggattatcaga
accaaagttcagcaacctttccacccaacaccagatgggagcggaaccggtgtggctgca
ccaggacatactatcgtgcccagcacagcatcccctcccgtctccagtgcctccaatgat
ccagtgggctcttactccattaacgggatcctggggattcctcggtcgaatggcgagaag
aggaaacgtgatgaagatgtatccgagggctctgttcccaacggagactcccagagcagc
gtggacagtttgcggaagcaccttcgtggcgacactttcacccagcagcagctggaagct
ttagatcgagtttttgagcgtccttcttaccctgacgtctttcaaacatcagagcacatc
aaatctgagcagggtaatgagtactccctcccagctctgacccctggtctcgatgaagtc
aaatcaagtctatccacctctgctaacccagacctggggacaaatgtgtcaggaccccag
acgtaccctgtggtgaccggtcgtgatatggcaagcaccaccttgcctggctacccaccc
catgttcccccaactggacaaggcagctacccaacctcaactctggcaggaatggttcct
gggagcgaattctcagggaacccctacagccaccctcagtacacaacctacaatgaggcc
tggcggttcagcaaccctgcattactaagttccccttattattatagtgccacatcccgg
ggctccgcacctcccactgctgccgctgcctatgaccgccactag

DBGET integrated database retrieval system