KEGG   Gallus gallus (chicken): 395583
Entry
395583            CDS       T01006                                 

Gene name
SPRY1
Definition
(RefSeq) protein sprouty homolog 1
  KO
K04704  protein sprouty homolog 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    395583 (SPRY1)
SSDB
Motif
Pfam: Sprouty
Other DBs
NCBI-GeneID: 395583
NCBI-ProteinID: NP_001090993
CGNC: 49385
Ensembl: ENSGALG00000042067
UniProt: A4LA71
Position
4
AA seq 321 aa
MEPQSQHGSGGSLVVIQQPSLDSRQRLEYERDSQPTAILSLDQIKAIRGSNDYTEGPSVV
KKSGPRTAPRQEKHERTHEIIPINVNNNYEHRPSHVGHVAHQHNARVPVLSRSTSTGSAA
SSGSNSSASSEQGLLGRSPPSWPGSGGHRSERTIQTQPKQSSLIVDDLKGPLKEDLTQHK
FICEQCGKCKCGECTAPRALPSCLACNRQCLCSAESMVEYGTCMCLVKGIFYHCSNDDEG
DSYADNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRGCYDRVNRPGCRCK
NSNTVYCKLESCPSRGQGKPS
NT seq 966 nt   +upstreamnt  +downstreamnt
atggagccccaaagccagcacggcagtggtggttcgctggtggtgattcagcagccctct
ctggacagccggcagcggctggagtacgagcgggacagccagcctacagctatcttgtcg
ctggaccagatcaaggcgatccgcggcagcaacgattacactgaaggtccatctgtggtg
aaaaaatccggtccgcggacagcaccgaggcaagagaagcacgagaggactcatgaaatc
ataccgattaatgtgaataacaactatgaacacagacccagccacgtggggcacgtggcg
catcagcataacgcaagggttcctgttttgagcagatcaaccagcacggggagcgcggcc
agctctgggagcaacagcagtgcttcttcagagcaaggactgttgggacggtcaccgccg
tcgtggccgggttcaggaggccacaggtccgagcggacaatccagacgcaacccaagcag
tcgtcgttgattgtagatgatctgaagggtcctttgaaagaggacttgacacagcacaag
tttatctgcgaacagtgtgggaagtgcaaatgcggcgagtgcacagccccgagggccttg
ccttcttgcttggcctgcaatcggcagtgcttgtgctccgcggagagcatggtggagtat
ggcacctgcatgtgtttggtcaaagggatcttctaccactgttctaacgacgatgaaggg
gactcatacgcggataatccctgctcttgctcccagtcacattgctgttctaggtacctg
tgcatgggagccatgtccttgtttttgccttgcttgctctgttaccctcctgcaaaagga
tgcctaaaactgtgtcgagggtgttacgaccgcgtcaatcgtccgggctgccgatgcaag
aactccaacactgtctattgtaaactggagagctgcccctcccggggtcagggcaagccg
tcatga

DBGET integrated database retrieval system